Methylocaldum marinum: sS8_4722 Help Entry sS8_4722          CDS       T05638                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mmai  Methylocaldum marinum Pathway mmai01100   Metabolic pathways mmai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     sS8_4722    00074 Mycolic acid biosynthesis     sS8_4722   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     sS8_4722 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  BBA36646 UniProt:  A0A250KYQ9 LinkDB All DBs Position 5110885..5111115 Genome browser AA seq 76 aa AA seqDB search MSDVAERVKKIVAEQLGVKEEVSNEASFVDDLGADSLDTVELVMALEEEFECEIPDEDAE KITTVQQAIDYIESHI NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtgatgtagcagagcgtgttaagaagatcgtggctgagcaattaggcgtaaaagaa gaagtctccaatgaagcttctttcgtcgacgatctcggcgccgattccttggacacggtc gaactggtgatggccttggaagaagagtttgaatgtgagattcccgacgaagacgcggaa aagatcaccactgtccagcaagcgatagactacatcgaaagccacatctga

DBGET integrated database retrieval system