Methylocaldum marinum: sS8_5600
Help
Entry
sS8_5600 CDS
T05638
Name
(GenBank) ribonuclease III
KO
K03685
ribonuclease III [EC:
3.1.26.3
]
Organism
mmai
Methylocaldum marinum
Pathway
mmai03008
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:
mmai00001
]
09120 Genetic Information Processing
09122 Translation
03008 Ribosome biogenesis in eukaryotes
sS8_5600
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03019 Messenger RNA biogenesis [BR:
mmai03019
]
sS8_5600
03009 Ribosome biogenesis [BR:
mmai03009
]
sS8_5600
03036 Chromosome and associated proteins [BR:
mmai03036
]
sS8_5600
Enzymes [BR:
mmai01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.26 Endoribonucleases producing 5'-phosphomonoesters
3.1.26.3 ribonuclease III
sS8_5600
Messenger RNA biogenesis [BR:
mmai03019
]
Prokaryotic type
Bacterial mRNA degradation factors
RNA degradosome components
Ribonucreases
sS8_5600
Ribosome biogenesis [BR:
mmai03009
]
Eukaryotic type
90S particles
RNase
sS8_5600
Prokaryotic type
rRNA processing factors
sS8_5600
Chromosome and associated proteins [BR:
mmai03036
]
Eukaryotic type
Gene silencing
microRNA pathway
Microprocessor complex
sS8_5600
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribonucleas_3_3
Ribonuclease_3
dsrm
RM44_endonuclase
DND1_DSRM
DSRM_2
PWWP_KDM3B
Motif
Other DBs
NCBI-ProteinID:
BBA37517
UniProt:
A0A286P4E0
LinkDB
All DBs
Position
6011008..6011700
Genome browser
AA seq
230 aa
AA seq
DB search
MILEPEKIAKKLGVSFKNPALVRRALTHRSAESENNERLEFLGDSVLGFVIAERLYEKFT
EADEGVLSRLRATLVNQTSLAELARKLNLGDYLVLGSGELKSGGYRRDSILSDALEAVIG
ALLIDQGMDACREWILKLFAEPIDGLSLRDWKKDPKTRLQELMQARGLELPIYNLKTVFG
QPHDQSFCVECRVSLIPVSCEGVGSSRKKAEQQAAEKMLDLLAEKLGLKP
NT seq
693 nt
NT seq
+upstream
nt +downstream
nt
gtgatattggaaccggaaaagatcgcgaaaaagctgggcgtgagtttcaagaatcccgct
ttggtcaggagggctctgacacaccgcagtgcggaaagcgagaacaatgaacgactcgaa
ttcctcggtgactccgtgctcgggttcgtaatcgcggagcggctttacgaaaagttcacg
gaagccgatgaaggagttctcagccggctgcgtgccactctcgtgaatcagacttccttg
gcggaattggcgcgcaaattgaatctgggcgattacctggtcttgggatcgggcgagttg
aaaagtggcgggtaccggcgtgactcgattttgtccgatgccttggaggccgttatcggt
gctttgcttatcgaccagggaatggacgcctgccgggagtggattttgaaacttttcgcc
gagcccatagacggcctttcattgcgggattggaaaaaagatccgaagacccgattgcag
gagctgatgcaggcgcgaggactcgaactgcccatttataatctcaaaacggtgtttggc
cagccgcatgaccagagcttctgcgtggagtgccgcgtttcgctgattccggtttcctgc
gagggtgttggctcttcccggaaaaaggcggagcagcaggcggcggaaaagatgttggat
ttgttggcggagaaattggggctcaaaccatga
DBGET
integrated database retrieval system