Methanococcus maripaludis KA1: MMKA1_01560 Help Entry MMKA1_01560       CDS       T03692                                  Symbol rpl40e Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mmak  Methanococcus maripaludis KA1 Pathway mmak03010   Ribosome Brite KEGG Orthology (KO) [BR:mmak00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MMKA1_01560 (rpl40e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MMKA1_01560 (rpl40e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmak03011]     MMKA1_01560 (rpl40e)    04121 Ubiquitin system [BR:mmak04121]     MMKA1_01560 (rpl40e) Ribosome [BR:mmak03011]  Ribosomal proteins   Eukaryotes    Large subunit     MMKA1_01560 (rpl40e)   Archaea     MMKA1_01560 (rpl40e) Ubiquitin system [BR:mmak04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MMKA1_01560 (rpl40e) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR DZR_2 SelP_N Zn_Ribbon_1 Zn_ribbon_RPAB4 HypA Zn_ribbon_13 zf-ChsH2 Motif Other DBs NCBI-ProteinID:  BAP60273 UniProt:  A0A2Z5PEA5 LinkDB All DBs Position 159258..159401 Genome browser AA seq 47 aa AA seqDB search MAFEEAIKRVFMKKICMKCNSRNSWKATKCRKCGYTNLRPKAKEARA NT seq 144 nt NT seq  +upstreamnt  +downstreamnt atggcattcgaagaagcaatcaaaagagtcttcatgaaaaagatttgcatgaaatgtaac tcaagaaactcatggaaagctacaaaatgtagaaaatgtggatacacaaatttaaggcct aaagcaaaagaagctagggcataa

DBGET integrated database retrieval system