KEGG   Mycobacterium marseillense: CKJ54_01665
Entry
CKJ54_01665       CDS       T05049                                 
Name
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00260  Glycine, serine and threonine metabolism
mmal00261  Monobactam biosynthesis
mmal00270  Cysteine and methionine metabolism
mmal00300  Lysine biosynthesis
mmal01100  Metabolic pathways
mmal01110  Biosynthesis of secondary metabolites
mmal01120  Microbial metabolism in diverse environments
mmal01210  2-Oxocarboxylic acid metabolism
mmal01230  Biosynthesis of amino acids
Module
mmal_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
mmal_M00017  Methionine biosynthesis, aspartate => homoserine => methionine
mmal_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKJ54_01665
   00270 Cysteine and methionine metabolism
    CKJ54_01665
   00300 Lysine biosynthesis
    CKJ54_01665
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    CKJ54_01665
Enzymes [BR:mmal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     CKJ54_01665
SSDB
Motif
Pfam: AA_kinase ACT_9 ACT_7 ACT Phage-MuB_C
Other DBs
NCBI-ProteinID: ASW88742
UniProt: A0AAC9VRK8
LinkDB
Position
335040..336305
AA seq 421 aa
MALVVQKYGGSSVANADRIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLMDLAQQVCPA
PPPRELDMLLTAGERISNALVAMAIESLGAQARSFTGSQAGVITTGTHGNAKIIDVTPGR
LQTALDEGRVVLVAGFQGVSQDTRDVTTLGRGGSDTTAVALAAALRADVCEIYTDVDGIF
SADPRIVHNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRYNIPVHVRSSYSENPGTV
VVGSIKDIAMEDPILTGVAHDRSEAKVTVVGIPDIPGYAARVFRALADADVNIDMVLQNV
SKVEDGKTDITFTCSRDSGPTAVAKLDALKDEIGFSQLLYDDHVGKVSLIGAGMRSHPGV
TATFCESLAEVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGEESATVYAGTG
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
gtggcgctcgtcgtgcagaagtacggcggatcctcagtggcgaacgccgatcggatccgg
cgcgtggccgagcgcatcgtcgctaccaagaagcagggcaacgacgtcgtcgtcgtcgtc
tccgccatgggcgacaccaccgacgacctgatggatctggcccagcaggtgtgtccggcc
ccgccgccgcgcgaactcgacatgctgctgaccgccggtgagcgcatctccaacgccctg
gtcgcgatggccatcgaatcgttgggtgcgcaggcgcgctcgttcaccggttcgcaggcc
ggcgtgatcaccaccggcacgcacggcaacgccaagatcattgacgtcaccccgggccgg
ctgcagaccgcgctcgacgagggacgcgtcgtgctggtggccggattccagggcgtcagc
caggacacccgggacgtcaccaccctgggccgcggcggttcggacaccaccgcggtggcc
ctggccgcggcgctgcgcgccgacgtctgcgagatctacaccgacgtcgacggcatcttc
agcgccgacccgaggatcgtgcacaacgcccgcaagctggacacggtcaccttcgaagaa
atgctcgagatggcggcttgcggcgccaaggttttgatgctgcgctgcgtggaatacgcg
cgccgctacaacattccggtgcacgtccgatcctcgtattcggaaaacccaggcaccgtc
gtcgtcggatcgatcaaggacatagccatggaagaccccatcctgaccggagtcgcgcac
gaccgcagcgaggccaaggtcaccgtcgtcggcatccccgacattcccggatatgccgcc
cgcgtcttccgggcgctcgccgatgccgacgtgaacatcgacatggtgttgcagaacgtc
tcgaaggtcgaggacggcaagaccgacatcaccttcacctgctcgcgcgacagtgggccc
accgcggtggccaagctcgacgcgctcaaggacgagatcgggttcagccagctgctctac
gacgaccacgtcggcaaggtgtcgctgatcggggcgggtatgcgcagccaccccggggtc
accgccaccttctgtgagtccctggccgaggtgggcgtcaacatcgagctgatctccacc
tccgagatccgcatctcggtgctgtgccgcgacaccgaactagataaggccgtcgtggcg
ttgcacgaggcgttcgggctcggcggcgaggagtcggcgacggtgtatgcggggacgggt
agataa

DBGET integrated database retrieval system