Mycobacterium mantenii: MMAN_14160 Help Entry MMAN_14160        CDS       T07431                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism mman  Mycobacterium mantenii Pathway mman01100   Metabolic pathways mman01110   Biosynthesis of secondary metabolites Module mman_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) mman_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:mman00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MMAN_14160    00074 Mycolic acid biosynthesis     MMAN_14160   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MMAN_14160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBY37282 UniProt:  A0A1X0G574 LinkDB All DBs Position 1519570..1519827 Genome browser AA seq 85 aa AA seqDB search MTEEDIRDVVLSVLTTIAPEVEPDEIRDDVLLRDQVDLDSMDWLTFLRGIHRRLNVDIPE SDYASLRTLADVVGYVERNASKTPH NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccgaagaagacatacgtgatgtggtcctgtccgtgctgacaaccatcgcgcccgag gtcgaacccgacgaaatacgcgacgacgttctgctgcgagatcaggtcgatcttgattcc atggactggctcaccttcctgcgcggtatacaccgccggttgaacgtcgatatcccggag tccgactacgcttcgctacggacgttggcggacgtggtgggctacgtcgagcggaatgcg tctaaaaccccgcactga

DBGET integrated database retrieval system