Methanococcus maripaludis OS7: MMOS7_04600 Help Entry MMOS7_04600       CDS       T03693                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mmao  Methanococcus maripaludis OS7 Pathway mmao03010   Ribosome Brite KEGG Orthology (KO) [BR:mmao00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MMOS7_04600 (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MMOS7_04600 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmao03011]     MMOS7_04600 (rps27ae)    04121 Ubiquitin system [BR:mmao04121]     MMOS7_04600 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmao04147]     MMOS7_04600 (rps27ae) Ribosome [BR:mmao03011]  Ribosomal proteins   Eukaryotes    Small subunit     MMOS7_04600 (rps27ae)   Archaea     MMOS7_04600 (rps27ae) Ubiquitin system [BR:mmao04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MMOS7_04600 (rps27ae) Exosome [BR:mmao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MMOS7_04600 (rps27ae)   Exosomal proteins of colorectal cancer cells    MMOS7_04600 (rps27ae) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Rcat_RNF216 Zn_ribbon_Nudix IBR_1 Ribosomal_L37e Zn_ribbon_IS1595 RUBY_RBDX Zn_ribbon_ACC Zn_ribbon_NUD Zn_ribbon_11 Zn_ribbon_8 DZR Cas12f1-like_TNB Zn_ribbon_3 HVO_2753_ZBP Lar_restr_allev DUF1936 Zn_Ribbon_1 Zn_Ribbon_TF zf-tcix Motif Other DBs NCBI-ProteinID:  BAP62546 UniProt:  A0A2Z5PLN6 LinkDB All DBs Position 439280..439483 Genome browser AA seq 67 aa AA seqDB search MAAKKGAKTSTKKSDYYKVEGNTVERLKKVCPKCGAGVFMAEHLNRFACGKCGYMEYKKN EKTESEE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggcagctaaaaaaggtgcaaaaacatcaacaaaaaaatcagattactacaaagttgaa ggaaacactgtagaaagattgaaaaaagtatgcccaaaatgcggtgcaggcgtattcatg gctgaacacttaaacagattcgcatgtggaaaatgtggatacatggaatacaaaaagaat gaaaaaacagaaagcgaagaataa

DBGET integrated database retrieval system