Mycolicibacterium mageritense: MMAGJ_38190
Help
Entry
MMAGJ_38190 CDS
T07395
Symbol
regX3
Name
(GenBank) sensory transduction protein regX3
KO
K07776
two-component system, OmpR family, response regulator RegX3
Organism
mmat
Mycolicibacterium mageritense
Pathway
mmat02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
mmat00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
MMAGJ_38190 (regX3)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
mmat02022
]
MMAGJ_38190 (regX3)
Two-component system [BR:
mmat02022
]
OmpR family
SenX3-RegX3 (phosphate starvation response)
MMAGJ_38190 (regX3)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Trans_reg_C
Response_reg
GlnR_1st
PDE8A_N
Hydrolase
Motif
Other DBs
NCBI-ProteinID:
BBX34537
UniProt:
A0ABM7HVB4
LinkDB
All DBs
Position
3919782..3920468
Genome browser
AA seq
228 aa
AA seq
DB search
MTSVLIVEDEESLADPLAFLLRKEGFEATVVGDGPSALAEFERSGADIVLLDLMLPGMSG
TDVCKQLRSRSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGT
ESDDSSLGDGVLEAGPVRMDVERHVVSVNGEAITLPLKEFDLLEYLMRNSGRVLTRGQLI
DRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLGYKLEG
NT seq
687 nt
NT seq
+upstream
nt +downstream
nt
atgaccagcgttttgatcgttgaggacgaggagtcgctggccgatcccctggccttcctg
ctgcgtaaggagggcttcgaggccaccgtggtgggcgacgggccgtcggctctggcagag
ttcgagcgttccggcgccgacatcgtgctgctggacctgatgctgccgggcatgagcggc
accgacgtgtgcaagcaattgcgttcgcgctcaagcgtgcccgtgatcatggtgaccgcg
cgcgacagcgagatcgacaaggtcgtcgggctcgagctgggggccgacgactatgtcacc
aagccgtattcggcccgcgagctcatcgcacggatccgggccgtgctgcgccgcggcacc
gagagcgacgacagtagcctcggagacggcgtgctggaggccggcccggtgcggatggac
gtcgagcggcatgtggtcagcgtcaacggtgaggcgatcaccttgccgctcaaggaattc
gacctcctcgagtatctgatgcgcaacagtgggcgcgtgctcacgcgcggtcagctcatc
gaccgcgtgtggggtgccgactatgtgggcgacaccaagaccctcgacgtgcacgtcaag
cggctgcggtccaagatcgaggccgacccggccaaccccgtgcacctggtcaccgtccgc
ggcctcggctacaaactcgaggggtag
DBGET
integrated database retrieval system