Methanolobus mangrovi: RE476_06555 Help Entry RE476_06555       CDS       T09569                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mmav  Methanolobus mangrovi Pathway mmav03010   Ribosome Brite KEGG Orthology (KO) [BR:mmav00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     RE476_06555   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     RE476_06555  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmav03011]     RE476_06555    04121 Ubiquitin system [BR:mmav04121]     RE476_06555   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmav04147]     RE476_06555 Ribosome [BR:mmav03011]  Ribosomal proteins   Eukaryotes    Small subunit     RE476_06555   Archaea     RE476_06555 Ubiquitin system [BR:mmav04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    RE476_06555 Exosome [BR:mmav04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    RE476_06555   Exosomal proteins of colorectal cancer cells    RE476_06555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Lar_restr_allev DUF1451 Cas12f1-like_TNB Zn_ribbon_3 DUF5795 IBR Zn_ribbon_IS1595 IBR_1 DZR_2 DZR Zn_ribbon_NUD Zn_ribbon_Nudix Zn_ribbon_ACC MqsA_antitoxin Zn_Ribbon_TF Zn_ribbon_13 DUF7575 Motif Other DBs NCBI-ProteinID:  WMW21078 UniProt:  A0AA51YI24 LinkDB All DBs Position 1377309..1377458 Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVSGDSIERTHQSCPRCGEGVFLAEHKDRRTCGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattactacaaagtaagcggtgactccattgagcgcacccaccagtca tgcccacgctgtggagaaggagtattccttgcagagcacaaagacaggcgtacttgtggc aagtgcggatacaccgaattcaagaaataa

DBGET integrated database retrieval system