Megasphaera massiliensis: LCQ47_04890 Help Entry LCQ47_04890       CDS       T07781                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mmax  Megasphaera massiliensis Pathway mmax01100   Metabolic pathways mmax01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmax00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LCQ47_04890    00074 Mycolic acid biosynthesis     LCQ47_04890   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LCQ47_04890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF5783 DUF1493 Phi-29_GP16_7 Motif Other DBs NCBI-ProteinID:  UBS54523 LinkDB All DBs Position complement(1050324..1050569) Genome browser AA seq 81 aa AA seqDB search MSEENTFEKVKSIVVEQLGVDEKEVKMDAAYIDDLGADSLDIVELIMAFEEEFNIEIPDD VAEKIKTVKDTVDYIEKEKKA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagaaaatacttttgaaaaagtaaagagcattgttgttgaacagttaggcgtt gacgaaaaagaagtcaaaatggacgctgcttacatcgatgatttaggcgctgattccttg gacatcgtagaactgatcatggctttcgaagaagaattcaatatcgaaatccctgacgat gttgctgaaaaaatcaaaactgtcaaagatacagttgattacattgaaaaggaaaagaaa gcataa

DBGET integrated database retrieval system