Methanosarcina mazei Tuc01: MmTuc01_0607 Help Entry MmTuc01_0607      CDS       T02477                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mmaz  Methanosarcina mazei Tuc01 Pathway mmaz03010   Ribosome Brite KEGG Orthology (KO) [BR:mmaz00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MmTuc01_0607   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MmTuc01_0607  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmaz03011]     MmTuc01_0607    04121 Ubiquitin system [BR:mmaz04121]     MmTuc01_0607   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmaz04147]     MmTuc01_0607 Ribosome [BR:mmaz03011]  Ribosomal proteins   Eukaryotes    Small subunit     MmTuc01_0607   Archaea     MmTuc01_0607 Ubiquitin system [BR:mmaz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MmTuc01_0607 Exosome [BR:mmaz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MmTuc01_0607   Exosomal proteins of colorectal cancer cells    MmTuc01_0607 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Zn_ribbon_RPB9 DUF6671 IBR_1 Zn_Ribbon_TF Cas12f1-like_TNB DUF1451 MqsA_antitoxin Zn_ribbon_IS1595 Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  AGF96025 UniProt:  M1Q181 LinkDB All DBs Position 603391..603540 Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRLKQFCPRCGPGVFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattattacaaagtccagggcgactccgtaaccagactcaaacagttc tgtcccagatgcggacccggtgtattccttgccgaccacaaaaaccgcctcgcctgcgga aagtgcggctacaccgaattcaagaaataa

DBGET integrated database retrieval system