Methylotenera mobilis: Mmol_1142 Help Entry Mmol_1142         CDS       T00942                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mmb  Methylotenera mobilis Pathway mmb01100   Metabolic pathways mmb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mmol_1142    00074 Mycolic acid biosynthesis     Mmol_1142   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mmol_1142 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB HLH DUF1896 Motif Other DBs NCBI-ProteinID:  ACT48048 UniProt:  C6WVU9 LinkDB All DBs Position complement(1238451..1238687) Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIVAEQLGANEADVKNASSFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKITTVQLAIDYINTNLK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgacatcgaacaacgtgttaaaaaaattgttgctgaacaactaggtgcaaatgaa gctgatgttaaaaatgcatcatcatttgtagatgatttaggtgctgattcactagataca gtagagttggtaatggcgctagaagaagagtttgactgtgaaatccctgatgaggaagca gaaaaaatcactacagttcaattagcgattgattacatcaatactaacctcaaataa

DBGET integrated database retrieval system