Methanococcus maripaludis X1: GYY_02295 Help Entry GYY_02295         CDS       T01584                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mmd  Methanococcus maripaludis X1 Pathway mmd03010   Ribosome Brite KEGG Orthology (KO) [BR:mmd00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     GYY_02295   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     GYY_02295  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmd03011]     GYY_02295    04121 Ubiquitin system [BR:mmd04121]     GYY_02295   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmd04147]     GYY_02295 Ribosome [BR:mmd03011]  Ribosomal proteins   Eukaryotes    Small subunit     GYY_02295   Archaea     GYY_02295 Ubiquitin system [BR:mmd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    GYY_02295 Exosome [BR:mmd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    GYY_02295   Exosomal proteins of colorectal cancer cells    GYY_02295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Rcat_RNF216 IBR_1 Zn_ribbon_Nudix Ribosomal_L37e Zn_ribbon_IS1595 Zn_ribbon_11 Lar_restr_allev Zn_ribbon_8 Cas12f1-like_TNB HVO_2753_ZBP zf-tcix DZR Zn_ribbon_3 DUF1936 DUF7340 Zn_Ribbon_TF Zn_Ribbon_1 Motif Other DBs NCBI-ProteinID:  AEK19342 UniProt:  G0H373 LinkDB All DBs Position 437163..437366 Genome browser AA seq 67 aa AA seqDB search MAAKKGAKTSTKKSDYYKVEGNTVERLKKACPKCGAGVFMAEHLNRFACGKCGYMEYKKN EKTESEE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggcagctaaaaaaggtgcaaaaacatcaacaaaaaaatcagattactacaaagttgaa ggaaacactgtagaaagattgaaaaaagcatgcccaaaatgtggtgcaggcgtattcatg gctgaacacttaaacagattcgcatgtggaaaatgtggatacatggaatacaaaaagaat gaaaaaacagaaagcgaagaataa

DBGET integrated database retrieval system