Martelella mediterranea: Mame_01200 Help Entry Mame_01200        CDS       T04757                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism mmed  Martelella mediterranea Pathway mmed00190   Oxidative phosphorylation mmed01100   Metabolic pathways mmed02020   Two-component system Module mmed_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:mmed00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Mame_01200  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Mame_01200 Enzymes [BR:mmed01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Mame_01200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AQZ50569 UniProt:  A0A1U9YYP9 LinkDB All DBs Position complement(1304571..1304696) Genome browser AA seq 41 aa AA seqDB search MWYFAWILGLPLAALFAVLNAMWYELMDDRARERENKGSGI NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcgcctggatcctcggtctgccgctcgcagcgctcttcgcggtgctgaac gccatgtggtacgaactgatggacgatcgcgccagggagcgcgagaacaagggcagtggc atctga

DBGET integrated database retrieval system