Martelella mediterranea: Mame_02672 Help Entry Mame_02672        CDS       T04757                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mmed  Martelella mediterranea Pathway mmed01100   Metabolic pathways mmed01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmed00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mame_02672 (acpP)    00074 Mycolic acid biosynthesis     Mame_02672 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mame_02672 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AQZ51998 UniProt:  A0A1U9Z2U8 LinkDB All DBs Position 2869798..2870034 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAIKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgttaagaaaattgtagttgaccacctgggcgtggatgcc gacaaggttgtcgaaagcgcaagcttcatcgacgatctcggcgccgactcgctcgatacc gtcgagctggtcatggccttcgaagaagagttcggtgtggaaatccccgacgatgccgct gattcgatcctcacggtcggcgatgccatcaagttcatcgaaaaggctcaggcctga

DBGET integrated database retrieval system