Marinobacter metalliresistant: NLK58_06870
Help
Entry
NLK58_06870 CDS
T10462
Symbol
mutL
Name
(GenBank) DNA mismatch repair endonuclease MutL
KO
K03572
DNA mismatch repair protein MutL
Organism
mmee Marinobacter metalliresistant
Pathway
mmee03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
mmee00001
]
09120 Genetic Information Processing
09124 Replication and repair
03430 Mismatch repair
NLK58_06870 (mutL)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
mmee03400
]
NLK58_06870 (mutL)
DNA repair and recombination proteins [BR:
mmee03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Molecular matchmaker
NLK58_06870 (mutL)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MutL_C
DNA_mis_repair
HATPase_c_3
HATPase_c
EspA_EspE
Motif
Other DBs
NCBI-ProteinID:
WZF89906
UniProt:
A0ABZ2W556
LinkDB
All DBs
Position
complement(1482066..1483970)
Genome browser
AA seq
634 aa
AA seq
DB search
MPPIRLLSPRLANQIAAGEVVERPASVVKELVENALDAGATRVDVEVEQGGVKLIRVRDD
GSGIEEDDLPLALSRHATSKIASLDDLEAVASLGFRGEALASISSVSRLALTSRTAEQEA
ASRVEVEGREMDARISPAAHPVGTTVEVRDLFFNTPARRKFLRTEKTEFNHVEECVRRQA
LSRFDAGFTLRHNQRVVQSLRPADSALDRERRIGALCGQQFIDNAVVIDAQATGLRLWGW
VALPTFSRSQSDLQYFFVNGRVIRDRLVAHAVRQAYRDVLYNNRHPAFVLYLEVDPATVD
VNVHPTKHEVRFRDGRLVHDFIFRTLHKALADVRPDDHFRGAVAQSFGREASAQAESAPA
MGAPGGASWNGQPAVPGYGHSGTSAGFGGQSQPQQEWRASDQMAFYQSLNAGGGTGSPQS
TPVGDRGATPIPTPPADSDEEPPLGYAIAQLHGIYILAQGRAGMIVVDMHAAHERITYER
MKRALAEQDLKSQPLLVPLSLAVSQKEAALTESHGDELQKLGLQIERIGPETLAVRQVPA
LLRGADAEQLVRDVLADLIAHGQSDRVEAVTHELLGTMACHGSVRANRQLTVPEMNSLLR
DMEATERSGQCNHGRPTWTLVTLSELDKLFLRGR
NT seq
1905 nt
NT seq
+upstream
nt +downstream
nt
atgccccccattcgattgctgtcaccacggctcgcgaaccagattgccgcgggtgaagtg
gtggagcgccccgcatctgtcgtcaaggaactggtcgaaaacgccctggatgccggtgcc
acccgggttgatgttgaggtggagcagggcggcgtcaagctgattcgcgtacgggacgac
ggcagcggtattgaagaggatgatttgccgctggccctgagccggcacgcgaccagcaag
atcgccagccttgacgatctggaagctgtcgcttccctgggctttcgtggtgaggcgctc
gccagcatcagttcggtttcccgcctggcgctgacttcccggacagccgagcaggaagcg
gcctcccgggtagaagtagagggccgggagatggacgccagaatctctcccgccgcacac
ccggtgggtaccaccgtcgaagtgcgtgatctgttctttaatacccctgcgcgccgcaag
tttctgcgcaccgaaaaaaccgaattcaaccacgttgaggagtgtgtgcgccggcaggcc
ctgagccggtttgatgccggtttcaccctccgtcataaccagcgggttgttcaaagcctg
aggcctgccgattcagcccttgaccgggagcggcggatcggtgccctgtgcgggcagcaa
ttcatcgacaatgcggtggttatcgatgcgcaagcaacggggcttcgtttgtggggctgg
gttgcgctgccgacattctcccgcagtcagtcggacctgcaatatttctttgtcaacggc
cgggtgattcgtgaccggctggtggctcatgccgtgcgccaggcctaccgggatgttctc
tataacaaccggcatccggcctttgtgctgtacctggaggtagacccggccacggtggat
gtgaatgtgcaccccacaaaacacgaagtccgtttccgggacggccggctggttcacgat
tttatcttcagaaccctgcacaaggccctggccgatgtccggccggatgatcatttccgg
ggcgctgtcgcccagtcctttggccgtgaagcgtcggctcaggcggaaagcgcaccggcc
atgggtgctccggggggcgcttcctggaatggccagccagcggtgccgggttacggtcat
tcaggcacatcagccggtttcggaggtcagtcacagcctcagcaggaatggcgcgccagt
gatcagatggcgttctatcagtccctgaacgccggtggcggaaccggaagcccgcagtcg
acaccggtcggtgaccggggtgccacgcccattccgacgccgccggccgacagtgatgag
gagccgccacttggctatgccattgcccagctgcacggtatctatatcctcgcccagggg
cgggcagggatgatcgtggtggacatgcatgctgcccacgagcgcataacctatgaacgg
atgaagcgggcccttgccgagcaggatctgaaaagccagccattgttagtcccgctgtct
ttggcggtcagccagaaagaggccgccctgaccgagagccatggtgatgagctgcagaag
cttggcctgcagatagaacggatcggcccggaaaccctggctgtccggcaggtgccggcg
cttttgcgaggtgccgacgccgaacagctggtgcgtgacgtgctggcggatctcattgcg
catggtcagagcgaccgggtggaagcggtcactcacgagctgctcggcaccatggcgtgc
catggttcggtcagagcgaaccgccagctcaccgttccggaaatgaactcattgctcaga
gatatggaagccaccgagcgaagcggccagtgcaatcacggccggccgacctggacactg
gtaaccctgtccgagctggacaagctgttcctgcgggggcgttag
DBGET
integrated database retrieval system