KEGG   Marinobacter metalliresistant: NLK58_16325
Entry
NLK58_16325       CDS       T10462                                 
Symbol
rpmJ
Name
(GenBank) 50S ribosomal protein L36
  KO
K02919  large subunit ribosomal protein L36
Organism
mmee  Marinobacter metalliresistant
Pathway
mmee03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmee00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NLK58_16325 (rpmJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmee03011]
    NLK58_16325 (rpmJ)
Ribosome [BR:mmee03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NLK58_16325 (rpmJ)
  Bacteria
    NLK58_16325 (rpmJ)
SSDB
Motif
Pfam: Ribosomal_L36
Other DBs
NCBI-ProteinID: WZF87876
UniProt: A0ABZ2W045
LinkDB
Position
3493161..3493274
AA seq 37 aa
MKVRASVKKICRNCKVIRRNGSVRVICSEPRHKQRQG
NT seq 114 nt   +upstreamnt  +downstreamnt
atgaaagtacgcgcttcggtaaagaaaatttgccgtaactgcaaagtaattcgtcgcaat
ggctcggtacgggtcatttgctcggagcctcgtcacaagcaacgccagggctga

DBGET integrated database retrieval system