Mesorhizobium mediterraneum: LRP31_26075 Help Entry LRP31_26075       CDS       T09205                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mmei  Mesorhizobium mediterraneum Pathway mmei01100   Metabolic pathways mmei01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmei00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LRP31_26075    00074 Mycolic acid biosynthesis     LRP31_26075   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LRP31_26075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  WIW52490 LinkDB All DBs Position complement(5321922..5322158) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIEHLGVDADKVTEQASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccgcagagcgcgtcaagaagatcgttatcgagcaccttggcgtcgatgcc gataaggtgacggagcaggcgagcttcatcgatgatctgggcgcggacagcctcgacacg gtcgaacttgtcatggcgttcgaagaagagttcggcgtcgaaattcccgacgatgcggcc gaaaccattctgactgttggcgatgcagtgaagtacatcgacaaggcttcggcctga

DBGET integrated database retrieval system