Methylococcus mesophilus: OOT43_05610 Help Entry OOT43_05610       CDS       T09468                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mmeo  Methylococcus mesophilus Pathway mmeo01100   Metabolic pathways mmeo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmeo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OOT43_05610 (acpP)    00074 Mycolic acid biosynthesis     OOT43_05610 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OOT43_05610 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UZR30118 LinkDB All DBs Position complement(1247068..1247298) Genome browser AA seq 76 aa AA seqDB search MSDIAERVKKIVAEQLGVKDEISNEASFVDDLGADSLDTVELVMALEEEFECEIPDEDAE KITTVQQAIDYIQTHT NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtgatatagcagaacgtgtaaagaagatcgtcgccgaacagttgggcgtgaaggac gaaatctcgaacgaggcttcctttgtggacgatctgggcgccgattctctggacacggtc gagctggtaatggctctcgaagaagaattcgagtgcgaaattcctgacgaggacgccgaa aagatcaccacggttcagcaggcgatcgattacatccagacccacacctga

DBGET integrated database retrieval system