Methylococcus mesophilus: OOT43_07870 Help Entry OOT43_07870       CDS       T09468                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism mmeo  Methylococcus mesophilus Brite KEGG Orthology (KO) [BR:mmeo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmeo03036]     OOT43_07870 (ftsL) Chromosome and associated proteins [BR:mmeo03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     OOT43_07870 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC DUF3263 Motif Other DBs NCBI-ProteinID:  UZR30539 LinkDB All DBs Position complement(1698229..1698486) Genome browser AA seq 85 aa AA seqDB search MTRVLLLSVVAVCSALGVVYAKYRTRMLFAEVQRLELALNQYDVELGQLQLEQNTWAEHG RVERLARSRLGMTLPARESIIYIKP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacacgagtactcctgctgtcggtggttgccgtttgttcggcgctgggcgtggtttat gcgaagtaccgcacgcgcatgctgttcgctgaggttcagcgtctggaactggccctgaat caatacgatgtggaactgggccagcttcagttggagcagaacacctgggccgagcatggc cgcgtcgaacgtctggctcgcagcaggctggggatgaccctgccggcgcgcgagtcgatc atttacatcaaaccctga

DBGET integrated database retrieval system