Methylobacterium mesophilicum: MMSR116_01495 Help Entry MMSR116_01495     CDS       T06344                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mmes  Methylobacterium mesophilicum Pathway mmes01100   Metabolic pathways mmes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MMSR116_01495    00074 Mycolic acid biosynthesis     MMSR116_01495   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MMSR116_01495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Homoserine_dh Motif Other DBs NCBI-ProteinID:  QGY00730 UniProt:  A0A6B9F9Z4 LinkDB All DBs Position 308577..308825 Genome browser AA seq 82 aa AA seqDB search MTDDAIYAGLTEIFRDFLADDTIVLTPETTADDVEGWDSSSHINILLAAEERFGVRMTSA EIEKLTSIGALVDLIRSKNPKL NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaccgacgacgcaatctacgccggcctgaccgagatcttccgcgacttcctcgccgac gatacgatcgtgctgacgccggagaccacggccgacgacgtcgagggctgggattcgtcg agccacatcaacatcctgctcgcggccgaggagcggttcggcgttcgcatgaccagcgcc gagatcgagaagctgacgagcatcggcgccctggtcgacctgatccggtccaagaacccg aaactctga

DBGET integrated database retrieval system