Methylobacterium mesophilicum: MMSR116_26500 Help Entry MMSR116_26500     CDS       T06344                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mmes  Methylobacterium mesophilicum Pathway mmes01100   Metabolic pathways mmes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MMSR116_26500    00074 Mycolic acid biosynthesis     MMSR116_26500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MMSR116_26500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  QGY05052 UniProt:  A0A6B9FSN1 LinkDB All DBs Position complement(5525370..5525609) Genome browser AA seq 79 aa AA seqDB search MSDIAERVKKIVVEHLGVEPEKVVESANFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIQTVGDAVKFLEKNSAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgagcgcgtgaagaagatcgtcgtcgagcacctgggcgtcgagccc gagaaggtggtcgagagcgccaacttcatcgacgacctcggtgccgacagcctcgacacg gtcgagctggtgatggccttcgaggaggagttcaacgtcgagatcccggacgatgcggcc gagacgatccagacggtgggcgacgccgtgaagttcctggagaagaactccgccgcctga

DBGET integrated database retrieval system