KEGG   Molossus molossus (Pallas's mastiff bat): 118627560
Entry
118627560         CDS       T07221                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
mmf  Molossus molossus (Pallas's mastiff bat)
Pathway
mmf04014  Ras signaling pathway
mmf04015  Rap1 signaling pathway
mmf04020  Calcium signaling pathway
mmf04022  cGMP-PKG signaling pathway
mmf04024  cAMP signaling pathway
mmf04070  Phosphatidylinositol signaling system
mmf04114  Oocyte meiosis
mmf04218  Cellular senescence
mmf04261  Adrenergic signaling in cardiomyocytes
mmf04270  Vascular smooth muscle contraction
mmf04371  Apelin signaling pathway
mmf04625  C-type lectin receptor signaling pathway
mmf04713  Circadian entrainment
mmf04720  Long-term potentiation
mmf04722  Neurotrophin signaling pathway
mmf04728  Dopaminergic synapse
mmf04740  Olfactory transduction
mmf04744  Phototransduction
mmf04750  Inflammatory mediator regulation of TRP channels
mmf04910  Insulin signaling pathway
mmf04912  GnRH signaling pathway
mmf04915  Estrogen signaling pathway
mmf04916  Melanogenesis
mmf04921  Oxytocin signaling pathway
mmf04922  Glucagon signaling pathway
mmf04924  Renin secretion
mmf04925  Aldosterone synthesis and secretion
mmf04970  Salivary secretion
mmf04971  Gastric acid secretion
mmf05010  Alzheimer disease
mmf05012  Parkinson disease
mmf05022  Pathways of neurodegeneration - multiple diseases
mmf05031  Amphetamine addiction
mmf05034  Alcoholism
mmf05133  Pertussis
mmf05152  Tuberculosis
mmf05163  Human cytomegalovirus infection
mmf05167  Kaposi sarcoma-associated herpesvirus infection
mmf05170  Human immunodeficiency virus 1 infection
mmf05200  Pathways in cancer
mmf05214  Glioma
mmf05417  Lipid and atherosclerosis
mmf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    118627560
   04015 Rap1 signaling pathway
    118627560
   04371 Apelin signaling pathway
    118627560
   04020 Calcium signaling pathway
    118627560
   04070 Phosphatidylinositol signaling system
    118627560
   04024 cAMP signaling pathway
    118627560
   04022 cGMP-PKG signaling pathway
    118627560
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    118627560
   04218 Cellular senescence
    118627560
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    118627560
  09152 Endocrine system
   04910 Insulin signaling pathway
    118627560
   04922 Glucagon signaling pathway
    118627560
   04912 GnRH signaling pathway
    118627560
   04915 Estrogen signaling pathway
    118627560
   04921 Oxytocin signaling pathway
    118627560
   04916 Melanogenesis
    118627560
   04924 Renin secretion
    118627560
   04925 Aldosterone synthesis and secretion
    118627560
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    118627560
   04270 Vascular smooth muscle contraction
    118627560
  09154 Digestive system
   04970 Salivary secretion
    118627560
   04971 Gastric acid secretion
    118627560
  09156 Nervous system
   04728 Dopaminergic synapse
    118627560
   04720 Long-term potentiation
    118627560
   04722 Neurotrophin signaling pathway
    118627560
  09157 Sensory system
   04744 Phototransduction
    118627560
   04740 Olfactory transduction
    118627560
   04750 Inflammatory mediator regulation of TRP channels
    118627560
  09159 Environmental adaptation
   04713 Circadian entrainment
    118627560
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118627560
  09162 Cancer: specific types
   05214 Glioma
    118627560
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    118627560
   05163 Human cytomegalovirus infection
    118627560
   05167 Kaposi sarcoma-associated herpesvirus infection
    118627560
  09171 Infectious disease: bacterial
   05133 Pertussis
    118627560
   05152 Tuberculosis
    118627560
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118627560
   05012 Parkinson disease
    118627560
   05022 Pathways of neurodegeneration - multiple diseases
    118627560
  09165 Substance dependence
   05031 Amphetamine addiction
    118627560
   05034 Alcoholism
    118627560
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118627560
   05418 Fluid shear stress and atherosclerosis
    118627560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmf01009]
    118627560
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmf04131]
    118627560
   03036 Chromosome and associated proteins [BR:mmf03036]
    118627560
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmf04147]
    118627560
Protein phosphatases and associated proteins [BR:mmf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     118627560
Membrane trafficking [BR:mmf04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    118627560
Chromosome and associated proteins [BR:mmf03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     118627560
Exosome [BR:mmf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   118627560
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EF_EFCAB10_C Allatotropin-like_C EF-hand_FSTL1 CFAP251_C SAPC2_N Dockerin_1 UPF0154 EF-hand_EFHB_C DUF7667
Other DBs
NCBI-GeneID: 118627560
NCBI-ProteinID: XP_036113721
LinkDB
Position
Unknown
AA seq 147 aa
MGMADQLTEEQVAEFKEAFSLLDKDGDGTITTKELGTVLQSLGRNPTEAELQDMINEVDG
TIDFLEFLTMMARQMKDTDSEEAICQPFGVFDKDGNGYISAAEPHHVMTNLGEKRTDEEV
DETIRDADIDGDGQVNYEEFVQVMTAK
NT seq 444 nt   +upstreamnt  +downstreamnt
atgggcatggctgatcaactgactgaagaacaggttgctgaattcaaggaagctttctcc
ctattggacaaagatggggatggcaccatcacaacaaaggaactcggcactgtcttgcag
tcactgggtcggaacccaacagaagccgaattgcaggatatgatcaatgaagtggatggc
accattgacttcctagagtttttgactatgatggctagacaaatgaaagatacggacagt
gaagaagcaatctgccagccattcggagtctttgacaaggatggcaatggttacatcagt
gcggcagaaccacatcatgtcatgacaaacttaggagaaaaacgaacagatgaagaagta
gatgaaacgatcagagacgcagatattgatggagatggacaagtcaactatgaggaattc
gtacaggtgatgactgcaaaatga

DBGET integrated database retrieval system