KEGG   Molossus molossus (Pallas's mastiff bat): 118637822
Entry
118637822         CDS       T07221                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
mmf  Molossus molossus (Pallas's mastiff bat)
Pathway
mmf01521  EGFR tyrosine kinase inhibitor resistance
mmf01522  Endocrine resistance
mmf04010  MAPK signaling pathway
mmf04012  ErbB signaling pathway
mmf04014  Ras signaling pathway
mmf04015  Rap1 signaling pathway
mmf04062  Chemokine signaling pathway
mmf04068  FoxO signaling pathway
mmf04071  Sphingolipid signaling pathway
mmf04072  Phospholipase D signaling pathway
mmf04137  Mitophagy - animal
mmf04140  Autophagy - animal
mmf04150  mTOR signaling pathway
mmf04151  PI3K-Akt signaling pathway
mmf04210  Apoptosis
mmf04211  Longevity regulating pathway
mmf04213  Longevity regulating pathway - multiple species
mmf04218  Cellular senescence
mmf04360  Axon guidance
mmf04370  VEGF signaling pathway
mmf04371  Apelin signaling pathway
mmf04540  Gap junction
mmf04550  Signaling pathways regulating pluripotency of stem cells
mmf04625  C-type lectin receptor signaling pathway
mmf04650  Natural killer cell mediated cytotoxicity
mmf04660  T cell receptor signaling pathway
mmf04662  B cell receptor signaling pathway
mmf04664  Fc epsilon RI signaling pathway
mmf04714  Thermogenesis
mmf04720  Long-term potentiation
mmf04722  Neurotrophin signaling pathway
mmf04725  Cholinergic synapse
mmf04726  Serotonergic synapse
mmf04730  Long-term depression
mmf04810  Regulation of actin cytoskeleton
mmf04910  Insulin signaling pathway
mmf04912  GnRH signaling pathway
mmf04915  Estrogen signaling pathway
mmf04916  Melanogenesis
mmf04917  Prolactin signaling pathway
mmf04919  Thyroid hormone signaling pathway
mmf04921  Oxytocin signaling pathway
mmf04926  Relaxin signaling pathway
mmf04929  GnRH secretion
mmf04933  AGE-RAGE signaling pathway in diabetic complications
mmf04935  Growth hormone synthesis, secretion and action
mmf05010  Alzheimer disease
mmf05022  Pathways of neurodegeneration - multiple diseases
mmf05034  Alcoholism
mmf05160  Hepatitis C
mmf05161  Hepatitis B
mmf05163  Human cytomegalovirus infection
mmf05165  Human papillomavirus infection
mmf05166  Human T-cell leukemia virus 1 infection
mmf05167  Kaposi sarcoma-associated herpesvirus infection
mmf05170  Human immunodeficiency virus 1 infection
mmf05200  Pathways in cancer
mmf05203  Viral carcinogenesis
mmf05205  Proteoglycans in cancer
mmf05206  MicroRNAs in cancer
mmf05207  Chemical carcinogenesis - receptor activation
mmf05208  Chemical carcinogenesis - reactive oxygen species
mmf05210  Colorectal cancer
mmf05211  Renal cell carcinoma
mmf05213  Endometrial cancer
mmf05214  Glioma
mmf05215  Prostate cancer
mmf05216  Thyroid cancer
mmf05218  Melanoma
mmf05219  Bladder cancer
mmf05220  Chronic myeloid leukemia
mmf05221  Acute myeloid leukemia
mmf05223  Non-small cell lung cancer
mmf05224  Breast cancer
mmf05225  Hepatocellular carcinoma
mmf05226  Gastric cancer
mmf05230  Central carbon metabolism in cancer
mmf05231  Choline metabolism in cancer
mmf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    118637822 (NRAS)
   04012 ErbB signaling pathway
    118637822 (NRAS)
   04014 Ras signaling pathway
    118637822 (NRAS)
   04015 Rap1 signaling pathway
    118637822 (NRAS)
   04370 VEGF signaling pathway
    118637822 (NRAS)
   04371 Apelin signaling pathway
    118637822 (NRAS)
   04068 FoxO signaling pathway
    118637822 (NRAS)
   04072 Phospholipase D signaling pathway
    118637822 (NRAS)
   04071 Sphingolipid signaling pathway
    118637822 (NRAS)
   04151 PI3K-Akt signaling pathway
    118637822 (NRAS)
   04150 mTOR signaling pathway
    118637822 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    118637822 (NRAS)
   04137 Mitophagy - animal
    118637822 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    118637822 (NRAS)
   04218 Cellular senescence
    118637822 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    118637822 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    118637822 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118637822 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    118637822 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    118637822 (NRAS)
   04660 T cell receptor signaling pathway
    118637822 (NRAS)
   04662 B cell receptor signaling pathway
    118637822 (NRAS)
   04664 Fc epsilon RI signaling pathway
    118637822 (NRAS)
   04062 Chemokine signaling pathway
    118637822 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    118637822 (NRAS)
   04929 GnRH secretion
    118637822 (NRAS)
   04912 GnRH signaling pathway
    118637822 (NRAS)
   04915 Estrogen signaling pathway
    118637822 (NRAS)
   04917 Prolactin signaling pathway
    118637822 (NRAS)
   04921 Oxytocin signaling pathway
    118637822 (NRAS)
   04926 Relaxin signaling pathway
    118637822 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    118637822 (NRAS)
   04919 Thyroid hormone signaling pathway
    118637822 (NRAS)
   04916 Melanogenesis
    118637822 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    118637822 (NRAS)
   04726 Serotonergic synapse
    118637822 (NRAS)
   04720 Long-term potentiation
    118637822 (NRAS)
   04730 Long-term depression
    118637822 (NRAS)
   04722 Neurotrophin signaling pathway
    118637822 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    118637822 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    118637822 (NRAS)
   04213 Longevity regulating pathway - multiple species
    118637822 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    118637822 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118637822 (NRAS)
   05206 MicroRNAs in cancer
    118637822 (NRAS)
   05205 Proteoglycans in cancer
    118637822 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    118637822 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    118637822 (NRAS)
   05203 Viral carcinogenesis
    118637822 (NRAS)
   05230 Central carbon metabolism in cancer
    118637822 (NRAS)
   05231 Choline metabolism in cancer
    118637822 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118637822 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    118637822 (NRAS)
   05225 Hepatocellular carcinoma
    118637822 (NRAS)
   05226 Gastric cancer
    118637822 (NRAS)
   05214 Glioma
    118637822 (NRAS)
   05216 Thyroid cancer
    118637822 (NRAS)
   05221 Acute myeloid leukemia
    118637822 (NRAS)
   05220 Chronic myeloid leukemia
    118637822 (NRAS)
   05218 Melanoma
    118637822 (NRAS)
   05211 Renal cell carcinoma
    118637822 (NRAS)
   05219 Bladder cancer
    118637822 (NRAS)
   05215 Prostate cancer
    118637822 (NRAS)
   05213 Endometrial cancer
    118637822 (NRAS)
   05224 Breast cancer
    118637822 (NRAS)
   05223 Non-small cell lung cancer
    118637822 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118637822 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    118637822 (NRAS)
   05161 Hepatitis B
    118637822 (NRAS)
   05160 Hepatitis C
    118637822 (NRAS)
   05163 Human cytomegalovirus infection
    118637822 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    118637822 (NRAS)
   05165 Human papillomavirus infection
    118637822 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118637822 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    118637822 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    118637822 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118637822 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    118637822 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118637822 (NRAS)
   01522 Endocrine resistance
    118637822 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmf04131]
    118637822 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmf04147]
    118637822 (NRAS)
   04031 GTP-binding proteins [BR:mmf04031]
    118637822 (NRAS)
Membrane trafficking [BR:mmf04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    118637822 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    118637822 (NRAS)
Exosome [BR:mmf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   118637822 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   118637822 (NRAS)
  Exosomal proteins of breast cancer cells
   118637822 (NRAS)
  Exosomal proteins of colorectal cancer cells
   118637822 (NRAS)
GTP-binding proteins [BR:mmf04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    118637822 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 118637822
NCBI-ProteinID: XP_036129310
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CLGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatatatgcggacaggcgaaggcttcctctgt
gtatttgctatcaataatagcaagtcatttgcagatattaacctctacagggaacagatt
aagcgagtaaaggactcagatgatgtacctatggtgctagtaggaaacaaatgtgatttg
ccaacaaggacagttgacaccaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaagctcaatagcagtgatgatgggactcaaggt
tgcttggggttgccttgtgtggtgatgtaa

DBGET integrated database retrieval system