KEGG   Molossus molossus (Pallas's mastiff bat): 118641000
Entry
118641000         CDS       T07221                                 
Symbol
BCL2A1
Name
(RefSeq) bcl-2-related protein A1
  KO
K02162  hematopoietic Bcl-2-related protein A1
Organism
mmf  Molossus molossus (Pallas's mastiff bat)
Pathway
mmf04064  NF-kappa B signaling pathway
mmf04210  Apoptosis
mmf05202  Transcriptional misregulation in cancer
mmf05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    118641000 (BCL2A1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    118641000 (BCL2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    118641000 (BCL2A1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    118641000 (BCL2A1)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 118641000
NCBI-ProteinID: XP_036134008
LinkDB
Position
Unknown
AA seq 171 aa
MSDCEPGYVQGLARDYLRYVLQAPAPAPGRASRLLQEVAFAVQTEIEATLKPVLDFDVPS
VERARAIFNEVMEKEFEDGVVNWGRIVTVFAFEGILAKKLLGERAPDADTAQEVSRFVAE
FLTRTAGEWIRQHGGWENGFVKKFEPKSCWLTFLEVTGKICGVLFLLQQYC
NT seq 516 nt   +upstreamnt  +downstreamnt
atgagcgactgcgagcccgggtacgtgcaggggctggcgcgggactacctgcgctacgtg
ctgcaggccccggcgcccgcgcccggccgggcctcccggctgctgcaggaggtggccttc
gccgtgcagacggagatcgaggcgacgctgaagcccgtgctggacttcgacgtgccgtcg
gtggagcgcgccagggccatcttcaacgaggtgatggagaaggagttcgaggacggcgtg
gtgaactggggccgcatcgtgacggtgttcgccttcgaggggatcctggccaagaagctg
ctgggggagcgcgccccggacgcggacactgcgcaggaggtctcccgcttcgtggccgag
ttcctcacgaggaccgcgggggagtggatccggcagcacggcggctgggaaaatggcttt
gtgaagaagtttgaacccaaatcttgttggctgactttcctggaagttacaggaaagatc
tgcggagtgttatttctcctgcagcagtactgctga

DBGET integrated database retrieval system