Methanothermobacter marburgensis: MTBMA_c07180 Help Entry MTBMA_c07180      CDS       T01297                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mmg  Methanothermobacter marburgensis Pathway mmg03010   Ribosome Brite KEGG Orthology (KO) [BR:mmg00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MTBMA_c07180 (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MTBMA_c07180 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmg03011]     MTBMA_c07180 (rps27ae)    04121 Ubiquitin system [BR:mmg04121]     MTBMA_c07180 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmg04147]     MTBMA_c07180 (rps27ae) Ribosome [BR:mmg03011]  Ribosomal proteins   Eukaryotes    Small subunit     MTBMA_c07180 (rps27ae)   Archaea     MTBMA_c07180 (rps27ae) Ubiquitin system [BR:mmg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MTBMA_c07180 (rps27ae) Exosome [BR:mmg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MTBMA_c07180 (rps27ae)   Exosomal proteins of colorectal cancer cells    MTBMA_c07180 (rps27ae) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e NCD3G Alsin_RLD Baculo_ME53 Motif Other DBs NCBI-ProteinID:  ADL58313 UniProt:  D9PVR5 LinkDB All DBs Position 652617..652772 Genome browser AA seq 51 aa AA seqDB search MKKFELYEVKGDKLVRKNPFCVRCSNGVFMADHGDRYACGKCGYTEWKNRE NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgaagaagttcgaactctacgaggtaaagggggataaactcgtaaggaagaaccccttc tgtgtgagatgctcaaacggtgtcttcatggctgaccatggggacagatacgcctgcggt aagtgcggatacaccgaatggaaaaacagggaatag

DBGET integrated database retrieval system