Methanothermobacter marburgensis: MTBMA_c09420 Help Entry MTBMA_c09420      CDS       T01297                                  Symbol rpl40e Name (GenBank) 50S ribosomal protein L40E   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mmg  Methanothermobacter marburgensis Pathway mmg03010   Ribosome Brite KEGG Orthology (KO) [BR:mmg00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MTBMA_c09420 (rpl40e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MTBMA_c09420 (rpl40e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmg03011]     MTBMA_c09420 (rpl40e)    04121 Ubiquitin system [BR:mmg04121]     MTBMA_c09420 (rpl40e) Ribosome [BR:mmg03011]  Ribosomal proteins   Eukaryotes    Large subunit     MTBMA_c09420 (rpl40e)   Archaea     MTBMA_c09420 (rpl40e) Ubiquitin system [BR:mmg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MTBMA_c09420 (rpl40e) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 Ribosomal_L40e DZR DZR_2 DHHC Zn_ribbon_RanBP Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  ADL58537 UniProt:  D9PWD9 LinkDB All DBs Position complement(886426..886572) Genome browser AA seq 48 aa AA seqDB search MARFEEAENRLFNIKICLKCNARNPPTAKTCRKCGYKGLRYKAKEPRG NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggcaagatttgaggaagcagaaaacagactattcaatatcaagatctgccttaaatgt aacgccaggaacccaccaactgcaaagacatgcaggaagtgcggttacaagggattaagg tacaaggcaaaggaaccaaggggttaa

DBGET integrated database retrieval system