Mycobacterium marinum M: MMAR_2277 Help Entry MMAR_2277         CDS       T00694                                  Symbol trxB1 Name (GenBank) thioredoxin TrxB1   KO K00384   thioredoxin reductase (NADPH) [EC:1.8.1.9] Organism mmi  Mycobacterium marinum M Pathway mmi00450   Selenocompound metabolism Brite KEGG Orthology (KO) [BR:mmi00001]  09100 Metabolism   09106 Metabolism of other amino acids    00450 Selenocompound metabolism     MMAR_2277 (trxB1) Enzymes [BR:mmi01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.1  With NAD+ or NADP+ as acceptor     1.8.1.9  thioredoxin-disulfide reductase (NADPH)      MMAR_2277 (trxB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 DUF6568 Thioredoxin_9 AhpC-TSA Thioredoxin_7 Redoxin OST3_OST6 Glutaredoxin HyaE Motif Other DBs NCBI-ProteinID:  ACC40726 UniProt:  B2HPC2 LinkDB All DBs Position 2741606..2741944 Genome browser AA seq 112 aa AA seqDB search MADMATQDLTAAKFSETVNDNDMVLVDFWASWCGPCRAFAPTFQASSEAHPDVVYAKVDT EAEQELAAAAQIRSIPTLMAFKKGKLLFNQPGALPAAALEDLVQQLKSYEVV NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggctgacatggctacccaagacttaacagctgcaaagttcagcgaaaccgtcaacgac aacgacatggtgctggtcgacttctgggcctcctggtgcggcccgtgtcgcgcgttcgcg cccacgttccaggcgtcctcggaggctcaccccgacgtcgtgtacgccaaggttgacacc gaggccgagcaggagctggctgcggccgcccagatccggtccattcctacgctgatggcc ttcaagaagggcaagctgctgttcaaccaacccggcgcgctgcccgcggcggctctcgag gacctggtgcaacagctcaagtcctacgaagtcgtctag

DBGET integrated database retrieval system