Methanosarcina mazei S-6: MSMAS_0709 Help Entry MSMAS_0709        CDS       T04532                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mmj  Methanosarcina mazei S-6 Pathway mmj03010   Ribosome Brite KEGG Orthology (KO) [BR:mmj00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSMAS_0709   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSMAS_0709  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmj03011]     MSMAS_0709    04121 Ubiquitin system [BR:mmj04121]     MSMAS_0709   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmj04147]     MSMAS_0709 Ribosome [BR:mmj03011]  Ribosomal proteins   Eukaryotes    Small subunit     MSMAS_0709   Archaea     MSMAS_0709 Ubiquitin system [BR:mmj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSMAS_0709 Exosome [BR:mmj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSMAS_0709   Exosomal proteins of colorectal cancer cells    MSMAS_0709 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Rcat_RNF216 Zn_ribbon_RPB9 IBR_1 Zn_Ribbon_TF Cas12f1-like_TNB Zn_ribbon_3 DUF6671 DUF1451 MqsA_antitoxin Zn_ribbon_IS1595 Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  AKB63905 UniProt:  A0A0E3RI79 LinkDB All DBs Position complement(852384..852533) Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRLKQFCPRCGPGVFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattattacaaagtccagggcgactccgtaaccagactcaaacagttc tgtcccagatgcggacccggtgtattccttgccgaccacaaaaaccgcctcgcctgcggg aagtgcggctacaccgaattcaagaaataa

DBGET integrated database retrieval system