Morganella morganii: MU9_581 Help Entry MU9_581           CDS       T02496                                  Name (GenBank) Putative cytoplasmic protein   KO K09892   cell division protein ZapB Organism mmk  Morganella morganii Brite KEGG Orthology (KO) [BR:mmk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmk03036]     MU9_581 Chromosome and associated proteins [BR:mmk03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     MU9_581 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Leu_zip Seryl_tRNA_N PspA_IM30 Nuf2_DHR10-like DUF3450 CtIP_N CC149 COG6_N dCache_2 CENP-F_leu_zip YabA KASH_CCD TMF_TATA_bd ERM_helical FlaC_arch DUF4795 DUF7491 UPF0242 T3SchapCesA XRCC4_CC TMF_DNA_bd Herpes_UL6 Prefoldin_2 CC2-LZ NRBF2 Occludin_ELL DivIC APG6_N ADIP DUF5660 DUF2968 Motif Other DBs NCBI-ProteinID:  AGG29627 UniProt:  J7U0T9 LinkDB All DBs Position 639138..639380 Genome browser AA seq 80 aa AA seqDB search MSFEVFEKLEAKVQQAIDTITLLQMEIDELKETNNNLNREVQNAAGARESLVRENEQLKQ EQAGWQERLRALLGKMDDVQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtatttgaaaagctggaagcaaaagtccagcaggctatcgacaccatc accctgttacagatggaaatcgacgaattaaaagaaacgaacaacaacctgaaccgcgaa gtgcagaatgcagccggtgcccgtgagtcactggtgcgtgaaaacgagcagctgaagcag gagcaggcaggctggcaggagcgtctgcgggctttgctgggtaagatggacgacgtccag taa

DBGET integrated database retrieval system