Marmota marmota marmota (Alpine marmot): 107133923 Help Entry 107133923         CDS       T09644                                  Name (RefSeq) putative claudin-24   KO K06087   claudin Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma03272   Virion - Hepatitis viruses mmma04382   Cornified envelope formation mmma04514   Cell adhesion molecules mmma04530   Tight junction mmma04670   Leukocyte transendothelial migration mmma05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mmma00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     107133923  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     107133923  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     107133923  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     107133923   09158 Development and regeneration    04382 Cornified envelope formation     107133923  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     107133923  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mmma03037]     107133923    04147 Exosome [BR:mmma04147]     107133923    04515 Cell adhesion molecules [BR:mmma04515]     107133923 Cilium and associated proteins [BR:mmma03037]  Other cilia and associated proteins   Stereociliary proteins    107133923 Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    107133923   Exosomal proteins of colorectal cancer cells    107133923 Cell adhesion molecules [BR:mmma04515]  Immunoglobulin superfamily   L1 family    107133923 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin SCA7 Motif Other DBs NCBI-GeneID:  107133923 NCBI-ProteinID:  XP_015331555 LinkDB All DBs Position Unknown AA seq 182 aa AA seqDB search MGSGALCLAQNVGLLVSVAGYVCSLVTLCIPQWLTFSSGLLENERYMLGLWETCMTQDFR GSVCQSHTAPQNLAAEMRVACILLCVASTAGSLGLVAIFLELTCLRYLGCREHSLEKNSN VVGGALFFLAGLTTLAPVSYITHVTVQKSWGSELPTNFPSYIYMDGIELEGDIHIKSCQG SK NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atgggaagtggggcactctgcttagctcaaaacgtggggctcctggtctccgtggctggc tatgtctgttccctggtgactctgtgcattcctcagtggctgactttctcctcaggttta ctcgagaatgagaggtacatgctgggcctctgggaaacgtgtatgactcaagacttccgt ggcagcgtgtgccagagccacacggcaccgcaaaacctggctgctgagatgcgtgtggct tgcatccttttgtgtgtggccagcaccgctggttcactcgggcttgtggccatcttcctg gaactcacctgtctgaggtacctgggctgccgagaacattctttggagaaaaacagcaat gttgtcgggggagctctgtttttcctggccggactcaccactttagcgcccgtgtcctac atcacccatgtcaccgttcagaaatcctggggctctgagctcccaaccaactttcccagt tatatctatatggatggcatcgagttggagggtgacattcatatcaagtcttgtcaagga tccaaatga

DBGET integrated database retrieval system