Marmota marmota marmota (Alpine marmot): 107137223 Help Entry 107137223         CDS       T09644                                  Symbol Ppp3r1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04010   MAPK signaling pathway mmma04020   Calcium signaling pathway mmma04022   cGMP-PKG signaling pathway mmma04114   Oocyte meiosis mmma04218   Cellular senescence mmma04310   Wnt signaling pathway mmma04360   Axon guidance mmma04370   VEGF signaling pathway mmma04380   Osteoclast differentiation mmma04625   C-type lectin receptor signaling pathway mmma04650   Natural killer cell mediated cytotoxicity mmma04658   Th1 and Th2 cell differentiation mmma04659   Th17 cell differentiation mmma04660   T cell receptor signaling pathway mmma04662   B cell receptor signaling pathway mmma04720   Long-term potentiation mmma04724   Glutamatergic synapse mmma04921   Oxytocin signaling pathway mmma04922   Glucagon signaling pathway mmma04924   Renin secretion mmma05010   Alzheimer disease mmma05014   Amyotrophic lateral sclerosis mmma05020   Prion disease mmma05022   Pathways of neurodegeneration - multiple diseases mmma05031   Amphetamine addiction mmma05152   Tuberculosis mmma05163   Human cytomegalovirus infection mmma05166   Human T-cell leukemia virus 1 infection mmma05167   Kaposi sarcoma-associated herpesvirus infection mmma05170   Human immunodeficiency virus 1 infection mmma05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmma05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     107137223 (Ppp3r1)    04022 cGMP-PKG signaling pathway     107137223 (Ppp3r1)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     107137223 (Ppp3r1)    04660 T cell receptor signaling pathway     107137223 (Ppp3r1)    04658 Th1 and Th2 cell differentiation     107137223 (Ppp3r1)    04659 Th17 cell differentiation     107137223 (Ppp3r1)    04662 B cell receptor signaling pathway     107137223 (Ppp3r1)   09152 Endocrine system    04922 Glucagon signaling pathway     107137223 (Ppp3r1)    04921 Oxytocin signaling pathway     107137223 (Ppp3r1)    04924 Renin secretion     107137223 (Ppp3r1)   09156 Nervous system    04724 Glutamatergic synapse     107137223 (Ppp3r1)    04720 Long-term potentiation     107137223 (Ppp3r1)   09158 Development and regeneration    04360 Axon guidance     107137223 (Ppp3r1)    04380 Osteoclast differentiation     107137223 (Ppp3r1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     107137223 (Ppp3r1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     107137223 (Ppp3r1)    05170 Human immunodeficiency virus 1 infection     107137223 (Ppp3r1)    05163 Human cytomegalovirus infection     107137223 (Ppp3r1)    05167 Kaposi sarcoma-associated herpesvirus infection     107137223 (Ppp3r1)   09171 Infectious disease: bacterial    05152 Tuberculosis     107137223 (Ppp3r1)   09164 Neurodegenerative disease    05010 Alzheimer disease     107137223 (Ppp3r1)    05014 Amyotrophic lateral sclerosis     107137223 (Ppp3r1)    05020 Prion disease     107137223 (Ppp3r1)    05022 Pathways of neurodegeneration - multiple diseases     107137223 (Ppp3r1)   09165 Substance dependence    05031 Amphetamine addiction     107137223 (Ppp3r1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107137223 (Ppp3r1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mmma01009]     107137223 (Ppp3r1) Protein phosphatases and associated proteins [BR:mmma01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107137223 (Ppp3r1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  107137223 NCBI-ProteinID:  XP_015335068 Ensembl:  ENSMMMG00000005651 UniProt:  A0AAJ7ESJ8 LinkDB All DBs Position Unknown AA seq 161 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVSMKELFYLLFILKTI NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgtgctcacactttgatgctgatgaaattaaaaggctaggaaaaagatttaagaagctg gatttggacaattctggttctttgagtgtggaagagttcatgtctctgcctgagttacaa cagaatcctttagtacaacgagtaatagatatatttgacacagatgggaatggagaagta gactttaaagaattcattgagggagtctctcagttcagtgtcaaaggagataaggagcag aaattgcggtttgctttccgtatctatgacatggataaagatggctatatttccaatggg gaactcttccaggtgttgaaaatgatggttgggaacaatctgaaagacacacagttacag caaattgtagacaaaaccataataaacgcagataaggatggagatgggagaatatccttt gaagaattctgtgctgtaagtatgaaagaactgttttacttattattcatattaaaaaca atctaa

DBGET integrated database retrieval system