Marmota marmota marmota (Alpine marmot): 107137748 Help Entry 107137748         CDS       T09644                                  Symbol Tomm20l Name (RefSeq) TOMM20-like protein 1   KO K17770   mitochondrial import receptor subunit TOM20 Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04137   Mitophagy - animal Brite KEGG Orthology (KO) [BR:mmma00001]  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     107137748 (Tomm20l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mmma03029]     107137748 (Tomm20l)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mmma02000]     107137748 (Tomm20l) Mitochondrial biogenesis [BR:mmma03029]  Mitochondrial protein import machinery   Outer membrane    Transporter outer membrane (TOM) complex     107137748 (Tomm20l) Transporters [BR:mmma02000]  Other transporters   Primary active transporters [TC:3]    107137748 (Tomm20l) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MAS20 Motif Other DBs NCBI-GeneID:  107137748 NCBI-ProteinID:  XP_015335684 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search ISNHILYNLYSLLNILKIFQFWDPAPNEKLQERFFQEIQMGELWLSRGDCRMGVEHLSNA LLLCGQPRELLKVFRHTLPPQVFEMLLQKIPLICQQLEAEMNEQECLEDG NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atcagtaaccatatactttacaatctttactcattgttaaacattttaaaaatctttcag ttttgggatccagcaccaaatgaaaaactacaagaacgtttttttcaagagatacagatg ggagaactttggctatctagaggggactgtagaatgggagttgaacatcttagcaatgcc cttttattgtgtgggcaaccacgggaacttctgaaggttttcagacatacactccctcct caggtatttgagatgctgttgcaaaaaatcccccttatttgccagcaacttgaggcagaa atgaatgaacaggaatgcttggaggatggatga

DBGET integrated database retrieval system