Marmota marmota marmota (Alpine marmot): 107140969 Help Entry 107140969         CDS       T09644                                  Symbol Hmgb1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma03410   Base excision repair mmma04140   Autophagy - animal mmma04217   Necroptosis mmma04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:mmma00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     107140969 (Hmgb1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107140969 (Hmgb1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107140969 (Hmgb1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmma03036]     107140969 (Hmgb1)    03400 DNA repair and recombination proteins [BR:mmma03400]     107140969 (Hmgb1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmma04147]     107140969 (Hmgb1) Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     107140969 (Hmgb1) DNA repair and recombination proteins [BR:mmma03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      107140969 (Hmgb1)    MMR (mismatch excision repair)     Other MMR factors      107140969 (Hmgb1) Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107140969 (Hmgb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  107140969 NCBI-ProteinID:  XP_015339670 Ensembl:  ENSMMMG00000021875 UniProt:  A0A8C6A4I3 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacccagatgcttcagtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt gaagacatggcaaaggcggacaaggcccgttatgaaagagaaatgaaaacctatatccct cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccgtcg gccttcttcttgttctgttctgagtatcgccccaaaatcaagggagaacatcctggccta tccattggtgatgttgcaaagaaactgggagagatgtggaataacactgctgcagatgat aagcagccttatgaaaagaaagctgccaagctgaaggaaaaatacgaaaaggatattgct gcctaccgagctaaaggaaaacctgatgcagcaaaaaagggagttgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaagag gaagatgaagaagatgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system