Marmota marmota marmota (Alpine marmot): 107143681 Help Entry 107143681         CDS       T09644                                  Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma01521   EGFR tyrosine kinase inhibitor resistance mmma01524   Platinum drug resistance mmma04014   Ras signaling pathway mmma04064   NF-kappa B signaling pathway mmma04115   p53 signaling pathway mmma04137   Mitophagy - animal mmma04140   Autophagy - animal mmma04151   PI3K-Akt signaling pathway mmma04210   Apoptosis mmma04215   Apoptosis - multiple species mmma04621   NOD-like receptor signaling pathway mmma04630   JAK-STAT signaling pathway mmma05012   Parkinson disease mmma05014   Amyotrophic lateral sclerosis mmma05022   Pathways of neurodegeneration - multiple diseases mmma05145   Toxoplasmosis mmma05162   Measles mmma05166   Human T-cell leukemia virus 1 infection mmma05168   Herpes simplex virus 1 infection mmma05170   Human immunodeficiency virus 1 infection mmma05200   Pathways in cancer mmma05202   Transcriptional misregulation in cancer mmma05212   Pancreatic cancer mmma05220   Chronic myeloid leukemia mmma05222   Small cell lung cancer mmma05225   Hepatocellular carcinoma mmma05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107143681    04630 JAK-STAT signaling pathway     107143681    04064 NF-kappa B signaling pathway     107143681    04151 PI3K-Akt signaling pathway     107143681  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107143681    04137 Mitophagy - animal     107143681   09143 Cell growth and death    04210 Apoptosis     107143681    04215 Apoptosis - multiple species     107143681    04115 p53 signaling pathway     107143681  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     107143681  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107143681    05202 Transcriptional misregulation in cancer     107143681   09162 Cancer: specific types    05212 Pancreatic cancer     107143681    05225 Hepatocellular carcinoma     107143681    05220 Chronic myeloid leukemia     107143681    05222 Small cell lung cancer     107143681   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     107143681    05170 Human immunodeficiency virus 1 infection     107143681    05162 Measles     107143681    05168 Herpes simplex virus 1 infection     107143681   09174 Infectious disease: parasitic    05145 Toxoplasmosis     107143681   09164 Neurodegenerative disease    05012 Parkinson disease     107143681    05014 Amyotrophic lateral sclerosis     107143681    05022 Pathways of neurodegeneration - multiple diseases     107143681   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107143681   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     107143681    01524 Platinum drug resistance     107143681  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mmma01009]     107143681   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmma03036]     107143681   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mmma02000]     107143681 Protein phosphatases and associated proteins [BR:mmma01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      107143681 Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     107143681 Transporters [BR:mmma02000]  Other transporters   Pores ion channels [TC:1]    107143681 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Motif Other DBs NCBI-GeneID:  107143681 NCBI-ProteinID:  XP_015342877 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQRNLELVMDFLSYKLSQKGYRWSQFSREEENRVQAPERAESEEGPSNATSGNPSRHQG DSPMVSGAAGHNRSLDAPDVVPMVAVKQAMREAGDNFEGRYRQAFHDLTAELRLTPETAH HTFEQVVDELFRDEVSWGRIVAFFFFGGALCLESIDKEMKVLVCQIASWMTTYLNDHLDT WIQDHGGWDTFVERHVNNVAVNSRMRQESFNYYFLMGMTVAGVVLLGWLFSPK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagaggaacctggaactagtgatggactttctgtcctacaagctttcccagaaa ggataccgctggagccagtttagccgtgaggaagagaaccgcgttcaagccccagaaagg gctgaatcagaagaggggcccagcaatgccaccagcggcaacccatcccggcatcagggg gacagtcccatggtgagtggagccgctggccataacaggagtttggatgcccccgacgtg gtccccatggtagcagtgaagcaagcgatgagggaggcaggcgacaactttgaagggcgg taccggcaggcattccatgacctgacagcagagctccgcctcaccccggagacagcacat cacacttttgaacaggtagtggacgaactcttccgggatgaggtaagctggggtcgcatt gtggcctttttcttctttggaggagcactgtgcttggaaagcatagacaaggagatgaag gtgttggtgtgtcagatcgcaagttggatgaccacttacctgaatgatcacctagatact tggatccaggaccacggcggctgggacacttttgtggaacgccatgtgaataatgtggca gtgaatagccggatgcgccaggagagtttcaactattatttcctgatgggcatgactgtg gctggcgtggttctgctgggctggctgttcagtcccaagtga

DBGET integrated database retrieval system