Marmota marmota marmota (Alpine marmot): 107144724 Help Entry 107144724         CDS       T09644                                  Symbol Pfn3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04015   Rap1 signaling pathway mmma04810   Regulation of actin cytoskeleton mmma05014   Amyotrophic lateral sclerosis mmma05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     107144724 (Pfn3)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     107144724 (Pfn3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmma04131]     107144724 (Pfn3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmma04812]     107144724 (Pfn3)    04147 Exosome [BR:mmma04147]     107144724 (Pfn3) Membrane trafficking [BR:mmma04131]  Others   Actin-binding proteins    Others     107144724 (Pfn3) Cytoskeleton proteins [BR:mmma04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      107144724 (Pfn3) Exosome [BR:mmma04147]  Exosomal proteins   Proteins found in most exosomes    107144724 (Pfn3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  107144724 NCBI-ProteinID:  XP_015344023 Ensembl:  ENSMMMG00000005053 UniProt:  A0A8C6EPB4 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSNNRCVWASRPGGLLAAISPQEVGVLVGPDRQAFL QAGLSLAGRRCCVIRDYLLAEGDGVLDARTKGLDTRAICVGHTPRALLVLMGRRGVHGGI LNKTVHELIRGLCTQCA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggtgactggaagggctacatcagtgcagtgctgcgagaccagcgcatcgacgacgta gccatcgtgggccactcaaacaatcgctgcgtgtgggcatcgcgacccgggggcctgctg gctgccatctcgccgcaggaggtgggcgtgcttgttgggcccgaccggcaggccttcctg caggcgggcctgagtttggcgggccgccgctgctgcgtcatccgcgactatctgctggca gagggagacggcgtgctggacgcgcgcaccaaggggctggacacgcgcgccatttgcgtg ggccacacgccgcgcgcgctcctcgtgctgatgggcagacgcggcgtgcacggtggcatc ctcaacaaaactgtgcacgagctgatccgcgggctgtgcacgcagtgcgcttag

DBGET integrated database retrieval system