Marmota marmota marmota (Alpine marmot): 107145041 Help Entry 107145041         CDS       T09644                                  Symbol Rab8a Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04140   Autophagy - animal mmma04144   Endocytosis mmma04152   AMPK signaling pathway mmma04530   Tight junction mmma04972   Pancreatic secretion mmma05014   Amyotrophic lateral sclerosis mmma05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     107145041 (Rab8a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107145041 (Rab8a)    04140 Autophagy - animal     107145041 (Rab8a)   09144 Cellular community - eukaryotes    04530 Tight junction     107145041 (Rab8a)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     107145041 (Rab8a)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     107145041 (Rab8a)    05022 Pathways of neurodegeneration - multiple diseases     107145041 (Rab8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmma04131]     107145041 (Rab8a)    03036 Chromosome and associated proteins [BR:mmma03036]     107145041 (Rab8a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmma04147]     107145041 (Rab8a)    04031 GTP-binding proteins [BR:mmma04031]     107145041 (Rab8a) Membrane trafficking [BR:mmma04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     107145041 (Rab8a)  Autophagy   Other autophagy associated proteins     107145041 (Rab8a) Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     107145041 (Rab8a) Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107145041 (Rab8a)   Exosomal proteins of other body fluids (saliva and urine)    107145041 (Rab8a)   Exosomal proteins of colorectal cancer cells    107145041 (Rab8a) GTP-binding proteins [BR:mmma04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     107145041 (Rab8a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU DUF3963 Motif Other DBs NCBI-GeneID:  107145041 NCBI-ProteinID:  XP_015344362 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search SGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIR NWIRNIEEHASADVEKMILGNKCDVNDKRQVSRERGEKLALDYGIKFMETSAKANINVEN AFFTLARDIKAKMDKKLEGNSPQGSSQGVKITPDQQKRSSFFRCALV NT seq 504 nt NT seq  +upstreamnt  +downstreamnt tcaggaattgactttaaaatcaggaccatagagctcgatggcaagaggatcaaactacag atatgggacacagccggccaggaacggttccggacgatcaccacggcctactaccgggga gccatgggtatcatgctggtctacgacatcaccaacgagaagtcctttgacaacatccgg aactggattcggaacattgaggagcacgcctctgcagacgtggagaagatgatacttggg aacaagtgtgatgtgaacgacaagagacaggtgtccagggaacggggagagaagctggcc cttgactatggaatcaagttcatggagaccagcgccaaggccaacatcaacgtggagaac gcatttttcaccctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agcccccagggcagcagccaaggcgtcaagatcacccccgaccagcagaagaggagcagc ttcttccgctgcgcgttggtgtga

DBGET integrated database retrieval system