Marmota marmota marmota (Alpine marmot): 107146495 Help Entry 107146495         CDS       T09644                                  Symbol Elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04066   HIF-1 signaling pathway mmma04120   Ubiquitin mediated proteolysis mmma05170   Human immunodeficiency virus 1 infection mmma05200   Pathways in cancer mmma05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mmma00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     107146495 (Elob)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     107146495 (Elob)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107146495 (Elob)   09162 Cancer: specific types    05211 Renal cell carcinoma     107146495 (Elob)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107146495 (Elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mmma04121]     107146495 (Elob)    03400 DNA repair and recombination proteins [BR:mmma03400]     107146495 (Elob) Ubiquitin system [BR:mmma04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      107146495 (Elob)    Cul5 complex      107146495 (Elob) DNA repair and recombination proteins [BR:mmma03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      107146495 (Elob) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  107146495 NCBI-ProteinID:  XP_015346081 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MHGTGEQEAEQNKQPPKVGGRSVPSRADELWPHLILSLPLTPSVVAGQRSVGLAPSGPLP RPFFSPQDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDAFEALRIEPFSSPPEL PDVMKPQDSGGSANEQAVQ NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgcatggaactggagaacaagaagctgagcagaataagcagcctccgaaggtcgggggt cgcagtgtcccctctcgcgcggacgagttatggccacacttgatactatctcttcctctg actcccagtgtagttgctggccagagatctgtgggtcttgccccttctggacctctcccc agacccttcttctctcctcaggatgaccagctcctcgatgacggcaaaactctgggagaa tgtggcttcactagccagacagcacggccacaggccccagccacagtggggctggccttc agggcagatgatgcctttgaggccttgcgcatcgagcccttctctagcccacccgagctt ccggacgtgatgaagcctcaggactccggaggcagcgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system