KEGG   Marmota marmota marmota (Alpine marmot): 107146562
Entry
107146562         CDS       T09644                                 
Symbol
Mapk3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mmma  Marmota marmota marmota (Alpine marmot)
Pathway
mmma01521  EGFR tyrosine kinase inhibitor resistance
mmma01522  Endocrine resistance
mmma01524  Platinum drug resistance
mmma04010  MAPK signaling pathway
mmma04012  ErbB signaling pathway
mmma04014  Ras signaling pathway
mmma04015  Rap1 signaling pathway
mmma04022  cGMP-PKG signaling pathway
mmma04024  cAMP signaling pathway
mmma04062  Chemokine signaling pathway
mmma04066  HIF-1 signaling pathway
mmma04068  FoxO signaling pathway
mmma04071  Sphingolipid signaling pathway
mmma04072  Phospholipase D signaling pathway
mmma04114  Oocyte meiosis
mmma04140  Autophagy - animal
mmma04148  Efferocytosis
mmma04150  mTOR signaling pathway
mmma04151  PI3K-Akt signaling pathway
mmma04210  Apoptosis
mmma04218  Cellular senescence
mmma04261  Adrenergic signaling in cardiomyocytes
mmma04270  Vascular smooth muscle contraction
mmma04350  TGF-beta signaling pathway
mmma04360  Axon guidance
mmma04370  VEGF signaling pathway
mmma04371  Apelin signaling pathway
mmma04380  Osteoclast differentiation
mmma04510  Focal adhesion
mmma04517  IgSF CAM signaling
mmma04520  Adherens junction
mmma04540  Gap junction
mmma04550  Signaling pathways regulating pluripotency of stem cells
mmma04611  Platelet activation
mmma04613  Neutrophil extracellular trap formation
mmma04620  Toll-like receptor signaling pathway
mmma04621  NOD-like receptor signaling pathway
mmma04625  C-type lectin receptor signaling pathway
mmma04650  Natural killer cell mediated cytotoxicity
mmma04657  IL-17 signaling pathway
mmma04658  Th1 and Th2 cell differentiation
mmma04659  Th17 cell differentiation
mmma04660  T cell receptor signaling pathway
mmma04662  B cell receptor signaling pathway
mmma04664  Fc epsilon RI signaling pathway
mmma04666  Fc gamma R-mediated phagocytosis
mmma04668  TNF signaling pathway
mmma04713  Circadian entrainment
mmma04720  Long-term potentiation
mmma04722  Neurotrophin signaling pathway
mmma04723  Retrograde endocannabinoid signaling
mmma04724  Glutamatergic synapse
mmma04725  Cholinergic synapse
mmma04726  Serotonergic synapse
mmma04730  Long-term depression
mmma04810  Regulation of actin cytoskeleton
mmma04910  Insulin signaling pathway
mmma04912  GnRH signaling pathway
mmma04914  Progesterone-mediated oocyte maturation
mmma04915  Estrogen signaling pathway
mmma04916  Melanogenesis
mmma04917  Prolactin signaling pathway
mmma04919  Thyroid hormone signaling pathway
mmma04921  Oxytocin signaling pathway
mmma04926  Relaxin signaling pathway
mmma04928  Parathyroid hormone synthesis, secretion and action
mmma04929  GnRH secretion
mmma04930  Type II diabetes mellitus
mmma04933  AGE-RAGE signaling pathway in diabetic complications
mmma04934  Cushing syndrome
mmma04935  Growth hormone synthesis, secretion and action
mmma04960  Aldosterone-regulated sodium reabsorption
mmma05010  Alzheimer disease
mmma05020  Prion disease
mmma05022  Pathways of neurodegeneration - multiple diseases
mmma05034  Alcoholism
mmma05132  Salmonella infection
mmma05133  Pertussis
mmma05135  Yersinia infection
mmma05140  Leishmaniasis
mmma05142  Chagas disease
mmma05145  Toxoplasmosis
mmma05152  Tuberculosis
mmma05160  Hepatitis C
mmma05161  Hepatitis B
mmma05163  Human cytomegalovirus infection
mmma05164  Influenza A
mmma05165  Human papillomavirus infection
mmma05166  Human T-cell leukemia virus 1 infection
mmma05167  Kaposi sarcoma-associated herpesvirus infection
mmma05170  Human immunodeficiency virus 1 infection
mmma05171  Coronavirus disease - COVID-19
mmma05200  Pathways in cancer
mmma05203  Viral carcinogenesis
mmma05205  Proteoglycans in cancer
mmma05206  MicroRNAs in cancer
mmma05207  Chemical carcinogenesis - receptor activation
mmma05208  Chemical carcinogenesis - reactive oxygen species
mmma05210  Colorectal cancer
mmma05211  Renal cell carcinoma
mmma05212  Pancreatic cancer
mmma05213  Endometrial cancer
mmma05214  Glioma
mmma05215  Prostate cancer
mmma05216  Thyroid cancer
mmma05218  Melanoma
mmma05219  Bladder cancer
mmma05220  Chronic myeloid leukemia
mmma05221  Acute myeloid leukemia
mmma05223  Non-small cell lung cancer
mmma05224  Breast cancer
mmma05225  Hepatocellular carcinoma
mmma05226  Gastric cancer
mmma05230  Central carbon metabolism in cancer
mmma05231  Choline metabolism in cancer
mmma05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmma05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107146562 (Mapk3)
   04012 ErbB signaling pathway
    107146562 (Mapk3)
   04014 Ras signaling pathway
    107146562 (Mapk3)
   04015 Rap1 signaling pathway
    107146562 (Mapk3)
   04350 TGF-beta signaling pathway
    107146562 (Mapk3)
   04370 VEGF signaling pathway
    107146562 (Mapk3)
   04371 Apelin signaling pathway
    107146562 (Mapk3)
   04668 TNF signaling pathway
    107146562 (Mapk3)
   04066 HIF-1 signaling pathway
    107146562 (Mapk3)
   04068 FoxO signaling pathway
    107146562 (Mapk3)
   04072 Phospholipase D signaling pathway
    107146562 (Mapk3)
   04071 Sphingolipid signaling pathway
    107146562 (Mapk3)
   04024 cAMP signaling pathway
    107146562 (Mapk3)
   04022 cGMP-PKG signaling pathway
    107146562 (Mapk3)
   04151 PI3K-Akt signaling pathway
    107146562 (Mapk3)
   04150 mTOR signaling pathway
    107146562 (Mapk3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    107146562 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107146562 (Mapk3)
   04148 Efferocytosis
    107146562 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107146562 (Mapk3)
   04210 Apoptosis
    107146562 (Mapk3)
   04218 Cellular senescence
    107146562 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107146562 (Mapk3)
   04520 Adherens junction
    107146562 (Mapk3)
   04540 Gap junction
    107146562 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    107146562 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107146562 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107146562 (Mapk3)
   04613 Neutrophil extracellular trap formation
    107146562 (Mapk3)
   04620 Toll-like receptor signaling pathway
    107146562 (Mapk3)
   04621 NOD-like receptor signaling pathway
    107146562 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    107146562 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    107146562 (Mapk3)
   04660 T cell receptor signaling pathway
    107146562 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    107146562 (Mapk3)
   04659 Th17 cell differentiation
    107146562 (Mapk3)
   04657 IL-17 signaling pathway
    107146562 (Mapk3)
   04662 B cell receptor signaling pathway
    107146562 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    107146562 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    107146562 (Mapk3)
   04062 Chemokine signaling pathway
    107146562 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107146562 (Mapk3)
   04929 GnRH secretion
    107146562 (Mapk3)
   04912 GnRH signaling pathway
    107146562 (Mapk3)
   04915 Estrogen signaling pathway
    107146562 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    107146562 (Mapk3)
   04917 Prolactin signaling pathway
    107146562 (Mapk3)
   04921 Oxytocin signaling pathway
    107146562 (Mapk3)
   04926 Relaxin signaling pathway
    107146562 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    107146562 (Mapk3)
   04919 Thyroid hormone signaling pathway
    107146562 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    107146562 (Mapk3)
   04916 Melanogenesis
    107146562 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107146562 (Mapk3)
   04270 Vascular smooth muscle contraction
    107146562 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107146562 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107146562 (Mapk3)
   04725 Cholinergic synapse
    107146562 (Mapk3)
   04726 Serotonergic synapse
    107146562 (Mapk3)
   04720 Long-term potentiation
    107146562 (Mapk3)
   04730 Long-term depression
    107146562 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    107146562 (Mapk3)
   04722 Neurotrophin signaling pathway
    107146562 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    107146562 (Mapk3)
   04380 Osteoclast differentiation
    107146562 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107146562 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107146562 (Mapk3)
   05206 MicroRNAs in cancer
    107146562 (Mapk3)
   05205 Proteoglycans in cancer
    107146562 (Mapk3)
   05207 Chemical carcinogenesis - receptor activation
    107146562 (Mapk3)
   05208 Chemical carcinogenesis - reactive oxygen species
    107146562 (Mapk3)
   05203 Viral carcinogenesis
    107146562 (Mapk3)
   05230 Central carbon metabolism in cancer
    107146562 (Mapk3)
   05231 Choline metabolism in cancer
    107146562 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107146562 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107146562 (Mapk3)
   05212 Pancreatic cancer
    107146562 (Mapk3)
   05225 Hepatocellular carcinoma
    107146562 (Mapk3)
   05226 Gastric cancer
    107146562 (Mapk3)
   05214 Glioma
    107146562 (Mapk3)
   05216 Thyroid cancer
    107146562 (Mapk3)
   05221 Acute myeloid leukemia
    107146562 (Mapk3)
   05220 Chronic myeloid leukemia
    107146562 (Mapk3)
   05218 Melanoma
    107146562 (Mapk3)
   05211 Renal cell carcinoma
    107146562 (Mapk3)
   05219 Bladder cancer
    107146562 (Mapk3)
   05215 Prostate cancer
    107146562 (Mapk3)
   05213 Endometrial cancer
    107146562 (Mapk3)
   05224 Breast cancer
    107146562 (Mapk3)
   05223 Non-small cell lung cancer
    107146562 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107146562 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    107146562 (Mapk3)
   05161 Hepatitis B
    107146562 (Mapk3)
   05160 Hepatitis C
    107146562 (Mapk3)
   05171 Coronavirus disease - COVID-19
    107146562 (Mapk3)
   05164 Influenza A
    107146562 (Mapk3)
   05163 Human cytomegalovirus infection
    107146562 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107146562 (Mapk3)
   05165 Human papillomavirus infection
    107146562 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107146562 (Mapk3)
   05135 Yersinia infection
    107146562 (Mapk3)
   05133 Pertussis
    107146562 (Mapk3)
   05152 Tuberculosis
    107146562 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107146562 (Mapk3)
   05140 Leishmaniasis
    107146562 (Mapk3)
   05142 Chagas disease
    107146562 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107146562 (Mapk3)
   05020 Prion disease
    107146562 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    107146562 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    107146562 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107146562 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107146562 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107146562 (Mapk3)
   04934 Cushing syndrome
    107146562 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107146562 (Mapk3)
   01524 Platinum drug resistance
    107146562 (Mapk3)
   01522 Endocrine resistance
    107146562 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmma01001]
    107146562 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmma03036]
    107146562 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmma04147]
    107146562 (Mapk3)
Enzymes [BR:mmma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107146562 (Mapk3)
Protein kinases [BR:mmma01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107146562 (Mapk3)
Chromosome and associated proteins [BR:mmma03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107146562 (Mapk3)
Exosome [BR:mmma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107146562 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 107146562
NCBI-ProteinID: XP_015346147
Ensembl: ENSMMMG00000023724
LinkDB
Position
Unknown
AA seq 348 aa
MVIWKDGSTFQRGRTHARRARYRLFSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQI
LLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQIL
RGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYR
APEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNC
IINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLE
QYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggtcatatggaaagatggcagtacctttcaaaggggccgcacgcatgccaggcgagcg
cgctaccgcttgttcagctcagcttatgaccatgtgcgcaagactcgagtggccatcaag
aagatcagccccttcgagcatcagacctactgccagcgcacactacgagagatccagatc
ttgctgcgcttccgccatgagaatgtcattggcatccgagacattcttcgggcacctaca
ctggaagccatgagagatgtctatattgtgcaggacctgatggagacagatctgtacaag
ttgctcaaaagccaacagctgagcaatgaccatatctgctacttcctctaccagatcctg
cggggcctcaagtatatccactcagccaatgtgctccaccgggatctaaagccctccaac
ctgcttatcaacaccacctgcgaccttaagatctgcgattttggcctggccaggattgct
gatcctgaacatgaccacactggctttctgacggagtatgtggcgacacgctggtaccgg
gctccagagatcatgcttaactccaagggctacaccaagtccatcgacatctggtctgtg
ggctgcattctggctgagatgctctccaatcggcccatcttccccggcaagcactacctg
gaccagctcaaccacattctgggtatcctggggtccccttctcaagaggacttgaattgt
attatcaacatgaaggcccgaaactacctacagtctctgccctccaagaccaaggtggcc
tgggccaagctttttcccaagtcagactcaaaagctcttgacctgctggaccggatgtta
accttcaaccccaacaaacgtatcacagtggaagaagcactggctcacccctacctggaa
cagtactatgaccccacagatgagccagtagccgaggagcccttcacttttgacatggag
ctggatgatctacccaaggagaggctgaaagagctcatcttccaggagacagcccgcttc
cagccaggggccccagaggccccataa

DBGET integrated database retrieval system