Marmota marmota marmota (Alpine marmot): 107148927 Help Entry 107148927         CDS       T09644                                  Name (RefSeq) histone H2B type 2-K1   KO K11252   histone H2B Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04613   Neutrophil extracellular trap formation mmma05034   Alcoholism mmma05203   Viral carcinogenesis mmma05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmma00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107148927  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     107148927   09163 Immune disease    05322 Systemic lupus erythematosus     107148927   09165 Substance dependence    05034 Alcoholism     107148927  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmma03036]     107148927   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmma04147]     107148927 Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107148927 Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107148927 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF DLIC Med3 Connexin Radial_spoke_3 Motif Other DBs NCBI-GeneID:  107148927 NCBI-ProteinID:  XP_015349145 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MSAELGRRRRQQQQQQQQQQQQQPRGRRRWSSGDKKSKKRSRRKETYSMYIYKVLKQVHP DIGISAKAMSIMNSFVNDIFERLAGEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHA VSEGTKAVTKYTSSK NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgagcgcagagcttgggcggcgtcggcggcagcagcagcaacagcagcagcagcagcag cagcaacaaccccggggccgcaggaggtggagctctggggacaaaaagtccaaaaaacgt agccggcgcaaagagacgtattcaatgtatatctacaaggtgctgaagcaggtgcacccg gatatcggcatctctgccaaggccatgagcatcatgaactcctttgtgaacgatattttt gagcggctggctggtgaagctgcccggctggcccagtactcaggccggacaaccctgact tcccgggaagtccagacagccgtgcgtctgctgttacctggggagctggccaagcatgct gtctcagagggcaccaaggctgtcaccaagtacaccagctccaagtga

DBGET integrated database retrieval system