Marmota marmota marmota (Alpine marmot): 107149316 Help Entry 107149316         CDS       T09644                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04613   Neutrophil extracellular trap formation mmma05034   Alcoholism mmma05202   Transcriptional misregulation in cancer mmma05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmma00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107149316  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     107149316   09163 Immune disease    05322 Systemic lupus erythematosus     107149316   09165 Substance dependence    05034 Alcoholism     107149316  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmma03036]     107149316   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmma04147]     107149316 Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107149316 Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107149316 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  107149316 NCBI-ProteinID:  XP_015349602 UniProt:  A0A8C5YLX1 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgcactaagcagaccgcgcgcaagtccaccggcggtaaagcgccgcgcaagcag ctggccaccaaggccgctcgcaagagcgccccggccaccggcggcgtcaagaagcctcac cgctaccggcccggcaccgtggcgctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccattccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggccctgcaggaggcctgcgaggcctac ctggtggggttgttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcccgccgcatccgcggggagagagcgtaa

DBGET integrated database retrieval system