Marmota marmota marmota (Alpine marmot): 107149358 Help Entry 107149358         CDS       T09644                                  Name (RefSeq) histone H2B type 1-K   KO K11252   histone H2B Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04613   Neutrophil extracellular trap formation mmma05034   Alcoholism mmma05203   Viral carcinogenesis mmma05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmma00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107149358  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     107149358   09163 Immune disease    05322 Systemic lupus erythematosus     107149358   09165 Substance dependence    05034 Alcoholism     107149358  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmma03036]     107149358   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmma04147]     107149358 Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107149358 Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107149358 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  107149358 NCBI-ProteinID:  XP_015349646 Ensembl:  ENSMMMG00000002660 UniProt:  A0A8C5YSQ9 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagagccctctaagtccgctcctgccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcctcgcgc ctggcgcactacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtcggagggcaccaaggcggtcacc aagtacaccagcgccaagtga

DBGET integrated database retrieval system