Marmota marmota marmota (Alpine marmot): 107150071 Help Entry 107150071         CDS       T09644                                  Symbol Brk1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04810   Regulation of actin cytoskeleton mmma05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmma00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     107150071 (Brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107150071 (Brk1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  107150071 NCBI-ProteinID:  XP_015350502 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggacaggaggatccggtgcaacgagagattcaccaagactgggcgaaccgggaa tacattgaagtcatcaccagcagcatcaagaaaatcgcggactttctcaattcgttcgat atgtcttgtcgttcaagactcgcaacactaaatgagaaattgacagcccttgaacggaga atagagtacattgaagcacgggtgacaaaaggtgagacgctcacctag

DBGET integrated database retrieval system