Marmota marmota marmota (Alpine marmot): 107150317 Help Entry 107150317         CDS       T09644                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04014   Ras signaling pathway mmma04015   Rap1 signaling pathway mmma04020   Calcium signaling pathway mmma04022   cGMP-PKG signaling pathway mmma04024   cAMP signaling pathway mmma04070   Phosphatidylinositol signaling system mmma04114   Oocyte meiosis mmma04218   Cellular senescence mmma04261   Adrenergic signaling in cardiomyocytes mmma04270   Vascular smooth muscle contraction mmma04371   Apelin signaling pathway mmma04625   C-type lectin receptor signaling pathway mmma04713   Circadian entrainment mmma04720   Long-term potentiation mmma04722   Neurotrophin signaling pathway mmma04728   Dopaminergic synapse mmma04740   Olfactory transduction mmma04744   Phototransduction mmma04750   Inflammatory mediator regulation of TRP channels mmma04910   Insulin signaling pathway mmma04912   GnRH signaling pathway mmma04915   Estrogen signaling pathway mmma04916   Melanogenesis mmma04921   Oxytocin signaling pathway mmma04922   Glucagon signaling pathway mmma04924   Renin secretion mmma04925   Aldosterone synthesis and secretion mmma04970   Salivary secretion mmma04971   Gastric acid secretion mmma05010   Alzheimer disease mmma05012   Parkinson disease mmma05022   Pathways of neurodegeneration - multiple diseases mmma05031   Amphetamine addiction mmma05034   Alcoholism mmma05133   Pertussis mmma05152   Tuberculosis mmma05163   Human cytomegalovirus infection mmma05167   Kaposi sarcoma-associated herpesvirus infection mmma05170   Human immunodeficiency virus 1 infection mmma05200   Pathways in cancer mmma05214   Glioma mmma05417   Lipid and atherosclerosis mmma05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107150317    04015 Rap1 signaling pathway     107150317    04070 Phosphatidylinositol signaling system     107150317    04024 cAMP signaling pathway     107150317    04022 cGMP-PKG signaling pathway     107150317  09150 Organismal Systems   09152 Endocrine system    04922 Glucagon signaling pathway     107150317    04915 Estrogen signaling pathway     107150317    04921 Oxytocin signaling pathway     107150317    04924 Renin secretion     107150317    04925 Aldosterone synthesis and secretion     107150317   09154 Digestive system    04970 Salivary secretion     107150317    04971 Gastric acid secretion     107150317   09156 Nervous system    04728 Dopaminergic synapse     107150317    04720 Long-term potentiation     107150317    04722 Neurotrophin signaling pathway     107150317   09157 Sensory system    04740 Olfactory transduction     107150317    04750 Inflammatory mediator regulation of TRP channels     107150317   09159 Environmental adaptation    04713 Circadian entrainment     107150317  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107150317   09162 Cancer: specific types    05214 Glioma     107150317   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107150317    05163 Human cytomegalovirus infection     107150317    05167 Kaposi sarcoma-associated herpesvirus infection     107150317   09171 Infectious disease: bacterial    05133 Pertussis     107150317    05152 Tuberculosis     107150317   09164 Neurodegenerative disease    05010 Alzheimer disease     107150317    05012 Parkinson disease     107150317    05022 Pathways of neurodegeneration - multiple diseases     107150317   09165 Substance dependence    05031 Amphetamine addiction     107150317    05034 Alcoholism     107150317   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107150317    05418 Fluid shear stress and atherosclerosis     107150317  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mmma01009]     107150317   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmma04131]     107150317    03036 Chromosome and associated proteins [BR:mmma03036]     107150317   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmma04147]     107150317 Protein phosphatases and associated proteins [BR:mmma01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107150317 Membrane trafficking [BR:mmma04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     107150317 Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      107150317 Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107150317 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 EFhand_Ca_insen Dockerin_1 DUF5580_M Caleosin FCaBP_EF-hand EF-hand_11 DUF1103 SurA_N_3 SurA_N_2 RFC1 Motif Other DBs NCBI-GeneID:  107150317 NCBI-ProteinID:  XP_015350782 Ensembl:  ENSMMMG00000014423 UniProt:  A0A8C6EU72 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MANQLTEEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQGMVNEIDRDG NGTVDFPEFLGMMARKMKDTDSEEEIREAFRVFDKDGNGYVSAAELRHVMTRLGEKLSDE EVEEMIRAADTDGDGQVNYEEFVRMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccaaccagctgaccgaggagcaaattgccgagttcaaggaagccttctctctgttt gacaaggacggggatggctgcattaccacccaggaactgggcaccgtcatgcggtccctg ggccagaaccccacagaggctgagctccagggcatggtgaacgagatcgaccgggatgga aatggcacggtggacttccccgagttcctgggcatgatggccaggaagatgaaagacacg gacagtgaggaggagatccgggaggccttccgcgtgttcgacaaggacggcaatggctat gtcagcgcagccgagctgaggcacgtgatgaccagactgggggagaagctgagcgatgag gaggtggaggagatgattcgggcagcagacacggacggagatgggcaagtgaactacgag gagtttgtgcgcatgctggtgtccaagtga

DBGET integrated database retrieval system