Marmota marmota marmota (Alpine marmot): 107150715 Help Entry 107150715         CDS       T09644                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04060   Cytokine-cytokine receptor interaction mmma04061   Viral protein interaction with cytokine and cytokine receptor mmma04062   Chemokine signaling pathway mmma04620   Toll-like receptor signaling pathway mmma05142   Chagas disease mmma05163   Human cytomegalovirus infection mmma05323   Rheumatoid arthritis mmma05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107150715    04061 Viral protein interaction with cytokine and cytokine receptor     107150715  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107150715    04062 Chemokine signaling pathway     107150715  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     107150715   09174 Infectious disease: parasitic    05142 Chagas disease     107150715   09163 Immune disease    05323 Rheumatoid arthritis     107150715   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107150715  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmma04052]     107150715    00536 Glycosaminoglycan binding proteins [BR:mmma00536]     107150715 Cytokines and neuropeptides [BR:mmma04052]  Cytokines   Chemokines    107150715 Glycosaminoglycan binding proteins [BR:mmma00536]  Heparan sulfate / Heparin   Chemokines    107150715 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107150715 NCBI-ProteinID:  XP_015351332 Ensembl:  ENSMMMG00000019060 UniProt:  A0A8C5ZZH8 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MEVPVAVLAVLFFTEALSSLTCSASLGADTPTACCFFYISRKIPRKFVDDYYETSSQCSK PAVIFQTKRGRQVCADPSEAWVRAYITDLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaggtccccgtggccgtcctcgctgtcctgttcttcactgaggccctctcctccctg acctgctcagcctccctgggtgctgacacccccaccgcctgctgcttcttctacatctcc cggaagattccgcgcaaatttgtagatgactattatgagaccagcagccagtgctccaaa ccggcggtcatcttccagaccaagagaggccggcaggtctgtgctgaccccagcgaggcg tgggttcgagcctacatcaccgacctggaactgaacgcctga

DBGET integrated database retrieval system