Marmota marmota marmota (Alpine marmot): 107151242 Help Entry 107151242         CDS       T09644                                  Symbol Rras Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04010   MAPK signaling pathway mmma04014   Ras signaling pathway mmma04015   Rap1 signaling pathway mmma04024   cAMP signaling pathway mmma04072   Phospholipase D signaling pathway mmma04137   Mitophagy - animal mmma04140   Autophagy - animal mmma04218   Cellular senescence mmma04360   Axon guidance mmma04371   Apelin signaling pathway mmma04625   C-type lectin receptor signaling pathway mmma04810   Regulation of actin cytoskeleton mmma05132   Salmonella infection mmma05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107151242 (Rras)    04014 Ras signaling pathway     107151242 (Rras)    04015 Rap1 signaling pathway     107151242 (Rras)    04371 Apelin signaling pathway     107151242 (Rras)    04072 Phospholipase D signaling pathway     107151242 (Rras)    04024 cAMP signaling pathway     107151242 (Rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107151242 (Rras)    04137 Mitophagy - animal     107151242 (Rras)   09143 Cell growth and death    04218 Cellular senescence     107151242 (Rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     107151242 (Rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107151242 (Rras)   09158 Development and regeneration    04360 Axon guidance     107151242 (Rras)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     107151242 (Rras)   09171 Infectious disease: bacterial    05132 Salmonella infection     107151242 (Rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mmma04031]     107151242 (Rras) GTP-binding proteins [BR:mmma04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     107151242 (Rras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  107151242 NCBI-ProteinID:  XP_015352020 Ensembl:  ENSMMMG00000008947 UniProt:  A0A8C5Z8Q0 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKDEGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggactgggcgggggcggccccggggcggggggccggga cccggggaccccccgcccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcactgaccatccagttcatccagtcctacttcgtgtctgactatgacccc accatcgaggactcctacacgaagatctgcaccgtggatggcatcccagcccggctggac atcctggacaccgcgggccaggaggaatttggggccatgcgggagcagtatatgcgagct ggccatggtttcctgctggtgtttgccattaacgaccggcaaagtttcaacgaagtgggc aaactcttcactcagatcctccgagtcaaggaccgtgatgacttccccattgtgctggtt gggaataaggcagatctggagacacagcgccaggtcccccgatctgaagcatctactttc agcgcctcccaccatgtggcctactttgaggcatcagccaaactgcgtctcaacgtggat gaggccttcgagcagctggtgcgggccgtcaggaaatatcaggaacaagagctcccaccc agccctcccagcgcccccaggaagaaggatgaaggctgcccctgtgtcctgctgtag

DBGET integrated database retrieval system