Marmota marmota marmota (Alpine marmot): 107152459 Help Entry 107152459         CDS       T09644                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04613   Neutrophil extracellular trap formation mmma05034   Alcoholism mmma05203   Viral carcinogenesis mmma05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmma00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107152459  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     107152459   09163 Immune disease    05322 Systemic lupus erythematosus     107152459   09165 Substance dependence    05034 Alcoholism     107152459  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmma03036]     107152459   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmma04147]     107152459 Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107152459 Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107152459 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF LonB_AAA-LID DUF1931 Motif Other DBs NCBI-GeneID:  107152459 NCBI-ProteinID:  XP_048652831 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MAEPTCDKSPEECLSPQEPENADRTTQKQKKPKCRSRRRTPGREDSFATYFPRVLKQVHV GLSLSQMAVNVMDSFIKDMFERIASEAGRLARQNHRSTITSREIQTAVRLLLPGEINKHA VSEGTMALLRHISRK NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggctgagccaacctgtgacaagtctcctgaggagtgcctcagtccccaggagcctgag aatgccgatcggacaacccagaagcagaagaagccaaagtgccgcagccgccgccgtacc ccaggacgcgaagacagtttcgccacctatttccccagggtgctgaagcaagtccacgtg ggtctcagcctttcccagatggcggtgaacgtgatggactcgttcattaaggacatgttc gagcgcatcgccagcgaggccggccgcctggcccgccaaaaccatcggtcgaccatcacc tccagagagatccagacggctgtgcgcctcctgctgcccggggagatcaacaaacacgcg gtgtctgagggcaccatggccctcctcaggcacatcagccgcaagtga

DBGET integrated database retrieval system