Marmota marmota marmota (Alpine marmot): 107153326 Help Entry 107153326         CDS       T09644                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04014   Ras signaling pathway mmma04015   Rap1 signaling pathway mmma04022   cGMP-PKG signaling pathway mmma04024   cAMP signaling pathway mmma04062   Chemokine signaling pathway mmma04071   Sphingolipid signaling pathway mmma04072   Phospholipase D signaling pathway mmma04081   Hormone signaling mmma04144   Endocytosis mmma04150   mTOR signaling pathway mmma04270   Vascular smooth muscle contraction mmma04310   Wnt signaling pathway mmma04350   TGF-beta signaling pathway mmma04360   Axon guidance mmma04510   Focal adhesion mmma04517   IgSF CAM signaling mmma04520   Adherens junction mmma04530   Tight junction mmma04611   Platelet activation mmma04621   NOD-like receptor signaling pathway mmma04625   C-type lectin receptor signaling pathway mmma04660   T cell receptor signaling pathway mmma04670   Leukocyte transendothelial migration mmma04722   Neurotrophin signaling pathway mmma04810   Regulation of actin cytoskeleton mmma04921   Oxytocin signaling pathway mmma04928   Parathyroid hormone synthesis, secretion and action mmma04972   Pancreatic secretion mmma05100   Bacterial invasion of epithelial cells mmma05132   Salmonella infection mmma05133   Pertussis mmma05135   Yersinia infection mmma05152   Tuberculosis mmma05163   Human cytomegalovirus infection mmma05200   Pathways in cancer mmma05203   Viral carcinogenesis mmma05205   Proteoglycans in cancer mmma05206   MicroRNAs in cancer mmma05210   Colorectal cancer mmma05417   Lipid and atherosclerosis mmma05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107153326    04015 Rap1 signaling pathway     107153326    04310 Wnt signaling pathway     107153326    04350 TGF-beta signaling pathway     107153326    04072 Phospholipase D signaling pathway     107153326    04071 Sphingolipid signaling pathway     107153326    04024 cAMP signaling pathway     107153326    04022 cGMP-PKG signaling pathway     107153326    04150 mTOR signaling pathway     107153326   09133 Signaling molecules and interaction    04081 Hormone signaling     107153326    04517 IgSF CAM signaling     107153326  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107153326   09144 Cellular community - eukaryotes    04510 Focal adhesion     107153326    04520 Adherens junction     107153326    04530 Tight junction     107153326   09142 Cell motility    04810 Regulation of actin cytoskeleton     107153326  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     107153326    04621 NOD-like receptor signaling pathway     107153326    04625 C-type lectin receptor signaling pathway     107153326    04660 T cell receptor signaling pathway     107153326    04670 Leukocyte transendothelial migration     107153326    04062 Chemokine signaling pathway     107153326   09152 Endocrine system    04921 Oxytocin signaling pathway     107153326    04928 Parathyroid hormone synthesis, secretion and action     107153326   09153 Circulatory system    04270 Vascular smooth muscle contraction     107153326   09154 Digestive system    04972 Pancreatic secretion     107153326   09156 Nervous system    04722 Neurotrophin signaling pathway     107153326   09158 Development and regeneration    04360 Axon guidance     107153326  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107153326    05206 MicroRNAs in cancer     107153326    05205 Proteoglycans in cancer     107153326    05203 Viral carcinogenesis     107153326   09162 Cancer: specific types    05210 Colorectal cancer     107153326   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     107153326   09171 Infectious disease: bacterial    05132 Salmonella infection     107153326    05135 Yersinia infection     107153326    05133 Pertussis     107153326    05152 Tuberculosis     107153326    05100 Bacterial invasion of epithelial cells     107153326   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107153326    05418 Fluid shear stress and atherosclerosis     107153326  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmma04131]     107153326   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmma04147]     107153326    04031 GTP-binding proteins [BR:mmma04031]     107153326 Membrane trafficking [BR:mmma04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     107153326 Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107153326   Exosomal proteins of other body fluids (saliva and urine)    107153326   Exosomal proteins of colorectal cancer cells    107153326   Exosomal proteins of bladder cancer cells    107153326 GTP-binding proteins [BR:mmma04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     107153326 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  107153326 NCBI-ProteinID:  XP_048663375 Ensembl:  ENSMMMG00000018259 UniProt:  A0A8C5ZZW5 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIKKKLVSVGDGASGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEAYDRLRPLSYPDTDVILMCFSIDNPDSLDNIIKKWTPEVKHFCPSVPILLVGNKND LRNDEHTRRKLAKMKQEPVKPEEGKDMANGIGAFGYMECSAKIKDGVRAVFEMATRAALQ PRCWKKKPRCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaagaagaagctggtgagtgttggtgatggagcaagtggcaagacatgc ttgctcatagttttcagcaaggaccagttcccagaagtatacgtgcccacagtgtttgag aactatgtggcagatatcgaagtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagcgtatgatcgcctgagacccctctcctacccagacactgatgttata ctgatgtgtttctccatcgacaatcctgacagtttagacaacatcataaaaaaatggacc ccagaagtcaagcatttctgtcccagtgtacccatcctcctggttgggaataagaatgat cttcggaatgatgagcacacaaggcggaagttagccaagatgaagcaggagccagtgaaa cctgaagaaggcaaagatatggctaatgggattggcgcctttgggtacatggagtgctca gcaaagattaaagatggagtgagggcagtttttgaaatggccacaagagctgctctgcaa cccagatgttggaagaaaaaacctaggtgccttgtcttgtga

DBGET integrated database retrieval system