Marmota marmota marmota (Alpine marmot): 107155408 Help Entry 107155408         CDS       T09644                                  Symbol Nppb Name (RefSeq) natriuretic peptides B   KO K12335   natriuretic peptide B Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04022   cGMP-PKG signaling pathway mmma04081   Hormone signaling mmma04270   Vascular smooth muscle contraction mmma04714   Thermogenesis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     107155408 (Nppb)   09133 Signaling molecules and interaction    04081 Hormone signaling     107155408 (Nppb)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     107155408 (Nppb)   09159 Environmental adaptation    04714 Thermogenesis     107155408 (Nppb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmma04052]     107155408 (Nppb) Cytokines and neuropeptides [BR:mmma04052]  Neuropeptides   Unclassified    107155408 (Nppb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  107155408 NCBI-ProteinID:  XP_015356781 Ensembl:  ENSMMMG00000016621 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MDPQMVLSRGSLLVLFLSLLLPGGRPHPLGSPGQAAELAGIQELLDRLQDEGSEPPAKPT ALEPLQQDQGPTEASEAAKAAPKGVPGPRDKVLQALRGLRTAKIMRDSGCFGRKLDRIGS YSRLGCNVLRRH NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggacccccagatggtgctgtcccggggaagtctgcttgtgcttttcctgagcctgttg ctgccaggaggtcgcccccacccgctgggcagccctggccaggctgcggagctcgccggg atacaggagctgctggatcgcctgcaggacgaggggtcagagccaccagcaaagccgacg gccctggagccgctccagcaggaccaaggccccacagaagcctcggaggctgcgaaggct gcccctaagggtgtccctgggcccagagacaaagtcctccaggctctgcggggacttcgc acagccaagataatgcgagactcgggttgcttcggacggaagttggaccggatcggctcc tacagccgcctgggctgcaatgtgctgaggcggcattag

DBGET integrated database retrieval system