Marmota marmota marmota (Alpine marmot): 107155450 Help Entry 107155450         CDS       T09644                                  Symbol Calml6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04014   Ras signaling pathway mmma04015   Rap1 signaling pathway mmma04020   Calcium signaling pathway mmma04022   cGMP-PKG signaling pathway mmma04024   cAMP signaling pathway mmma04070   Phosphatidylinositol signaling system mmma04114   Oocyte meiosis mmma04218   Cellular senescence mmma04261   Adrenergic signaling in cardiomyocytes mmma04270   Vascular smooth muscle contraction mmma04371   Apelin signaling pathway mmma04625   C-type lectin receptor signaling pathway mmma04713   Circadian entrainment mmma04720   Long-term potentiation mmma04722   Neurotrophin signaling pathway mmma04728   Dopaminergic synapse mmma04740   Olfactory transduction mmma04744   Phototransduction mmma04750   Inflammatory mediator regulation of TRP channels mmma04910   Insulin signaling pathway mmma04912   GnRH signaling pathway mmma04915   Estrogen signaling pathway mmma04916   Melanogenesis mmma04921   Oxytocin signaling pathway mmma04922   Glucagon signaling pathway mmma04924   Renin secretion mmma04925   Aldosterone synthesis and secretion mmma04970   Salivary secretion mmma04971   Gastric acid secretion mmma05010   Alzheimer disease mmma05012   Parkinson disease mmma05022   Pathways of neurodegeneration - multiple diseases mmma05031   Amphetamine addiction mmma05034   Alcoholism mmma05133   Pertussis mmma05152   Tuberculosis mmma05163   Human cytomegalovirus infection mmma05167   Kaposi sarcoma-associated herpesvirus infection mmma05170   Human immunodeficiency virus 1 infection mmma05200   Pathways in cancer mmma05214   Glioma mmma05417   Lipid and atherosclerosis mmma05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107155450 (Calml6)    04015 Rap1 signaling pathway     107155450 (Calml6)    04371 Apelin signaling pathway     107155450 (Calml6)    04020 Calcium signaling pathway     107155450 (Calml6)    04070 Phosphatidylinositol signaling system     107155450 (Calml6)    04024 cAMP signaling pathway     107155450 (Calml6)    04022 cGMP-PKG signaling pathway     107155450 (Calml6)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     107155450 (Calml6)    04218 Cellular senescence     107155450 (Calml6)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107155450 (Calml6)   09152 Endocrine system    04910 Insulin signaling pathway     107155450 (Calml6)    04922 Glucagon signaling pathway     107155450 (Calml6)    04912 GnRH signaling pathway     107155450 (Calml6)    04915 Estrogen signaling pathway     107155450 (Calml6)    04921 Oxytocin signaling pathway     107155450 (Calml6)    04916 Melanogenesis     107155450 (Calml6)    04924 Renin secretion     107155450 (Calml6)    04925 Aldosterone synthesis and secretion     107155450 (Calml6)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     107155450 (Calml6)    04270 Vascular smooth muscle contraction     107155450 (Calml6)   09154 Digestive system    04970 Salivary secretion     107155450 (Calml6)    04971 Gastric acid secretion     107155450 (Calml6)   09156 Nervous system    04728 Dopaminergic synapse     107155450 (Calml6)    04720 Long-term potentiation     107155450 (Calml6)    04722 Neurotrophin signaling pathway     107155450 (Calml6)   09157 Sensory system    04744 Phototransduction     107155450 (Calml6)    04740 Olfactory transduction     107155450 (Calml6)    04750 Inflammatory mediator regulation of TRP channels     107155450 (Calml6)   09159 Environmental adaptation    04713 Circadian entrainment     107155450 (Calml6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107155450 (Calml6)   09162 Cancer: specific types    05214 Glioma     107155450 (Calml6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107155450 (Calml6)    05163 Human cytomegalovirus infection     107155450 (Calml6)    05167 Kaposi sarcoma-associated herpesvirus infection     107155450 (Calml6)   09171 Infectious disease: bacterial    05133 Pertussis     107155450 (Calml6)    05152 Tuberculosis     107155450 (Calml6)   09164 Neurodegenerative disease    05010 Alzheimer disease     107155450 (Calml6)    05012 Parkinson disease     107155450 (Calml6)    05022 Pathways of neurodegeneration - multiple diseases     107155450 (Calml6)   09165 Substance dependence    05031 Amphetamine addiction     107155450 (Calml6)    05034 Alcoholism     107155450 (Calml6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107155450 (Calml6)    05418 Fluid shear stress and atherosclerosis     107155450 (Calml6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mmma01009]     107155450 (Calml6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmma04131]     107155450 (Calml6)    03036 Chromosome and associated proteins [BR:mmma03036]     107155450 (Calml6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmma04147]     107155450 (Calml6) Protein phosphatases and associated proteins [BR:mmma01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107155450 (Calml6) Membrane trafficking [BR:mmma04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     107155450 (Calml6) Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      107155450 (Calml6) Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107155450 (Calml6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH Dynamin_N Motif Other DBs NCBI-GeneID:  107155450 NCBI-ProteinID:  XP_048639769 Ensembl:  ENSMMMG00000019136 LinkDB All DBs Position Unknown AA seq 185 aa AA seqDB search MGALKGGQVHRPGQWAKRAPGETGCGCPLQTERLSAEQIKEYKGVFEMFDEEGNGEVKTG ELERLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGIYHEKAQNQEGELRAAF RVFDKESKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDGTIDYEEFVAMMTGES FKLVQ NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atgggtgccctgaagggtggccaggtgcacagacctggacagtgggccaagagagcccct ggtgagactgggtgcggctgtcccctgcagacggagcgcctgtcagctgagcagatcaag gaatacaagggggtctttgagatgtttgatgaggagggcaacggggaggtgaagaccgga gagctggagcggctcatgagcctgttgggcatcaaccccaccaagagcgaactggcctcc atggccaaggacgtggacagagacaacaaaggcttcttcaactgtgatggtttcttggcg ctgatggggatttaccatgagaaggcccagaaccaggagggagagctgagggcagcgttc cgggtcttcgacaaggagagcaagggctacatcgactggaacacactcaagtacgtgctc atgaatgcaggtgagcccctcaatgaggtggaggccgagcagatgatgaaggaggcggac aaggacggagacggaaccatcgactatgaggagttcgtggccatgatgaccggagagtcc ttcaagctggttcagtaa

DBGET integrated database retrieval system