Marmota marmota marmota (Alpine marmot): 107156464 Help Entry 107156464         CDS       T09644                                  Name (RefSeq) dynactin subunit 6-like   KO K10428   dynactin 6 Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04814   Motor proteins mmma04962   Vasopressin-regulated water reabsorption mmma05014   Amyotrophic lateral sclerosis mmma05016   Huntington disease mmma05022   Pathways of neurodegeneration - multiple diseases mmma05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmma00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     107156464  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     107156464  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107156464   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     107156464    05016 Huntington disease     107156464    05022 Pathways of neurodegeneration - multiple diseases     107156464  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmma03036]     107156464   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmma04812]     107156464 Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      107156464 Cytoskeleton proteins [BR:mmma04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      107156464 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hexapep DCTN5 Motif Other DBs NCBI-GeneID:  107156464 NCBI-ProteinID:  XP_048639891 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENT VIYGADCLRQVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgatcattggcaccaacaatgtgtttgaagttggctgttattcccaagccatgaaaatg ggggataacaatgtcattgaatcaaaagcatatgtaggcagaaatgtaatattgacaagt ggttgcatcattggggcttgttgcaacctaaatacttttgaagtcatccctgagaataca gtgatctatggtgcagactgccttcgtcaggtgcaaactgagcgaccacagccccagact ctacaactggatttcttgatgaaaatcttgccaaattatcaccacctaaagaagactatg aaaggaagctcaaccccagttaagaactga

DBGET integrated database retrieval system